KEGG   Echinicola strongylocentroti: DN752_12850Help
Entry
DN752_12850       CDS       T05506                                 

Definition
(GenBank) glutamate--tRNA ligase
  KO
K01885  glutamyl-tRNA synthetase [EC:6.1.1.17]
Organism
est  Echinicola strongylocentroti
Pathway
est00860  Porphyrin and chlorophyll metabolism
est00970  Aminoacyl-tRNA biosynthesis
est01100  Metabolic pathways
est01110  Biosynthesis of secondary metabolites
est01120  Microbial metabolism in diverse environments
Module
est_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:est00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    DN752_12850
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    DN752_12850
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:est01007]
    DN752_12850
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:est03016]
    DN752_12850
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:est02048]
    DN752_12850
Enzymes [BR:est01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.17  glutamate---tRNA ligase
     DN752_12850
Amino acid related enzymes [BR:est01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   DN752_12850
Transfer RNA biogenesis [BR:est03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    DN752_12850
 Prokaryotic Type
   Other AARSs
    DN752_12850
Prokaryotic defense system [BR:est02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   Type II TA system related factors
    DN752_12850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1c
Motif
Other DBs
NCBI-ProteinID: AWW33167
UniProt: A0A2Z4IQN1
Position
complement(3304788..3306329)
Genome map
AA seq 513 aa AA seqDB search
MTKEVRVRFAPSPTGALHIGGVRTALYNYLFAKKNQGKFLLRIEDTDQTRFVPGAEEYIK
EALEWIGITPDESPWVDGPHGPYRQSERKPHYMQYAEDLVEKGHAYYAFDTAEELDAMRE
RLTAARVVSPQYNSITRTQMKNSLTLPEDEVKGRLESGDPYVIRLKVPRKEEIRLNDMIR
GWVMVHSNTLDDKVLMKSDGMPTYHLANIVDDHLMGITHVIRGEEWLPSAPIHVLLYRYL
GWEDTMPQFAHLPLLLKPDGNGKLSKRDADKNGFPIFPMDWTDPRTGDFSQGFRQAGYFP
DAFVNFLAFLGWNPGDNQEIFSMEELINAFSVERIGKSGTKFDINKAKWFNEQYLKAKSN
HDLAQYLIEDLKKENIEILQAKAEQIVAIMKERATFPADLWKEGRFMLIAPTEFDEKVAA
KKWNEDAVAVLTAYKETLGKFEGEFSPQTAKSMLESAAESQEIKFGKVMQAVRLAVTGVG
AGPDLMEIFTIIGKEELIKRIDFALDTLEVKAK
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgactaaagaagtacgtgttcgttttgctccatcccctacaggagccctccatatcggt
ggtgtccgcactgccctatacaactatctttttgcgaagaaaaaccagggtaaattcctg
ttgaggatagaagacaccgaccagacgagatttgtcccaggcgctgaagaatacatcaag
gaagcattggagtggataggcattactccggacgaaagtccttgggtagatggcccccac
ggtccttaccgtcaatcagagcgaaaaccgcattatatgcaatatgccgaggatttggta
gaaaaaggccatgcgtactatgcttttgatactgccgaagagctggacgccatgcgtgag
cggcttactgcagctagggtggtgtctccacaatacaattcgatcaccaggactcagatg
aaaaattccctgacccttccagaggatgaggtaaagggtcgattggaatccggtgatcct
tatgtgatccgcttaaaggtacccagaaaagaagaaatccgcctcaatgacatgatccgt
ggttgggtaatggtgcattcgaacaccttggacgacaaggtgctgatgaaatccgacggc
atgcccacttaccaccttgccaatatcgtagatgaccacctgatgggcatcacgcatgta
attcgtggcgaggagtggttaccttctgcgcctatccacgtattattgtacaggtacttg
ggctgggaagataccatgcctcagtttgcccacctaccgctcctgctaaaacccgatggg
aatggcaaactctccaagagagatgcggacaagaatggtttccctattttcccaatggac
tggaccgacccgagaacaggagacttctcacaaggatttagacaggcgggttattttcca
gatgcttttgtcaacttcttggccttcttgggctggaatcctggcgacaaccaagaaatc
ttcagcatggaagagctgatcaatgccttctccgtagagcgaattggtaaatcgggaacg
aaatttgatatcaataaggcaaagtggtttaacgaacaatacctcaaagccaagtctaac
catgacctggcacagtacctgatcgaggaccttaagaaggaaaacatcgaaatcctccag
gccaaagcagagcaaattgtagccatcatgaaagaacgggctactttccccgcagatctt
tggaaagaaggacggttcatgttgattgcccctacggagtttgatgaaaaagtagcagca
aaaaaatggaatgaagacgctgtggcagtgctgacagcatataaagaaacacttgggaaa
tttgaaggagagttttctcctcaaacggccaaatccatgctggaatctgctgccgaaagc
caagaaatcaaattcggcaaagtcatgcaggcagtacgtctggcagtgactggtgtaggt
gctggccctgatttaatggaaatttttaccataattggtaaagaggaactaatcaaaaga
atcgattttgcgttagatacattagaggtcaaggcaaaataa

DBGET integrated database retrieval system