KEGG   Echinicola strongylocentroti: DN752_16485Help
Entry
DN752_16485       CDS       T05506                                 

Definition
(GenBank) beta-hexosaminidase
  KO
K12373  hexosaminidase [EC:3.2.1.52]
Organism
est  Echinicola strongylocentroti
Pathway
est00511  Other glycan degradation
est00520  Amino sugar and nucleotide sugar metabolism
est01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:est00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    DN752_16485
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    DN752_16485
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:est03110]
    DN752_16485
Enzymes [BR:est01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     DN752_16485
Chaperones and folding catalysts [BR:est03110]
 Intramolecular chaperones
  Others
   DN752_16485
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_20 Glyco_hydro_20b Glycohydro_20b2
Motif
Other DBs
NCBI-ProteinID: AWW31590
UniProt: A0A2Z4ILJ3
Position
complement(4260179..4261762)
Genome map
AA seq 527 aa AA seqDB search
MKIYCLFFFAYLSSLVSFGQSSPEIIPLPTTFEGGEEYFSITPKTKIHYSNDLLKEEAYF
LQKELLERKSFPISIQTSEATKSGINLALTETQDGGYQLFIDQTTGITITSATETGIFQG
IISLLQLADQADASHGQLAIPTWKINDSPAYAWRGFMLDESRHFFGVEKVKSLLDWMAYY
KLNKFHWHLTDAQGWRIAIKKYPKLALVGGIGDNSDPYAPAQYYSQSQIQEIVRYAAERK
IDIIPEIDMPGHATAANKAYPEFSGGGSEKYPEFTFHPAKEGTYQYLTDILREVDALFPG
HMIHLGGDEVSFGNQQWKNDPEVQQLMASQQLEDLKDVEDYFMKRMADSLFSLNNTILAW
DEMAEAGLPTSQSILLWWRHDQPQQLQKLLDNDIPTVICPRIPLYFDFVQQENDRFGRKW
GGNFNPLQRVYDFSLTKLNIPASKTSLILGFQANLWTETVTNEDRLDYLTFPRLAALAEI
AWTPEEQKDFEDFSTRLKNHLALYQKAGIYFYDPFDPKNHPEPVLKK
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatatattgcctattcttttttgcttacttatcctccttggtttccttcggccaa
agcagccctgaaatcattccgctaccgaccactttcgagggtggagaagaatacttttcc
atcaccccaaaaacaaaaatccactactcaaatgacctgctaaaagaggaggcctatttt
ttgcaaaaagaacttcttgaaagaaaatcattccccattagcatacaaacctccgaagcg
acaaaatccggaatcaacttggccctgacggaaacccaagatggcggctaccaactgttt
atcgaccagaccaccggtatcaccatcacttccgctactgaaaccggcatattccaaggc
atcatctcgctgctgcaattggcagatcaagcggatgcttcccacggtcagctggccatc
cctacttggaaaatcaacgactctccggcatacgcttggaggggattcatgctggatgag
tcgaggcacttctttggtgtggaaaaagtaaaatccctacttgactggatggcctattac
aagctcaacaaattccattggcaccttaccgatgcgcaaggatggcgaatagccatcaaa
aagtaccccaaactggcgctggttggcggcattggcgataacagcgatccctacgccccc
gctcaatactacagccaatctcaaatccaagaaatcgtccgctatgcagcagaaagaaaa
atcgatatcattcccgagatcgacatgccggggcatgccactgcggccaacaaagcttac
cctgaatttagtggcggtgggtcagaaaaatatccggaattcacctttcatcctgccaaa
gagggcacttaccaatacctgacagacattctccgagaagttgacgcgcttttccctggg
cacatgatccatctaggtggagatgaagtgagttttgggaaccaacaatggaaaaatgac
ccagaagtgcaacaactgatggcctcccagcaattggaggacctgaaggacgtggaggat
tactttatgaaacgaatggctgactcactcttctccctgaacaacaccatacttgcttgg
gacgaaatggccgaagctggcctccctacgagccaaagcatcttgctctggtggcgtcat
gatcagcctcagcagctacaaaaactattggacaatgatatccccacagtcatctgcccg
agaataccgctatattttgattttgtccagcaggaaaatgaccgttttggcagaaaatgg
ggcggtaatttcaatccacttcagcgtgtctatgattttagcttaaccaagctgaacatc
cctgcctccaaaacttcattgattctgggatttcaggctaatttatggacagaaacggtc
actaatgaagatcgcttggactatttgacttttcccagactggcagcgcttgcagagatc
gcttggacgccagaagagcaaaaagattttgaagacttctccactagactgaaaaatcac
cttgccctttaccaaaaagcggggatttacttttacgatcctttcgatcctaaaaaccac
ccagaaccggtactaaaaaaataa

DBGET integrated database retrieval system