KEGG   Eubacterium siraeum 70/3: EUS_02500Help
Entry
EUS_02500         CDS       T02590                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
esu  Eubacterium siraeum 70/3
Pathway
esu00450  Selenocompound metabolism
esu00970  Aminoacyl-tRNA biosynthesis
esu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:esu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    EUS_02500
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    EUS_02500
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:esu01007]
    EUS_02500
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:esu03016]
    EUS_02500
Enzymes [BR:esu01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     EUS_02500
Amino acid related enzymes [BR:esu01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   EUS_02500
Transfer RNA biogenesis [BR:esu03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    EUS_02500
 Prokaryotic type
   Other AARSs
    EUS_02500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e Anticodon_1 tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: CBK95585
UniProt: D4JR66
Position
complement(248702..250630)
Genome map
AA seq 642 aa AA seqDB search
MNKTYYLTTPIYYPSGNPHIGHCYTTVACDTIARFKRMQGYDVMFLTGTDEHGQKIELKA
AEKGVTPKEYVDEIVANFKRLWETMHISYDRFIRTTDDYHIETVQKIFRKLYEKGYIYKG
TYKGKYCTPCESFWTESQLVDGKCPDCGREVKEANEEAYFLRLSDFADKIEKFLTETDYL
QPKSRVNEMVNNFIKPGLEDLCVSRTSFTWGIPVDFDSKHVVYVWVDALSNYISALGYGN
EKYNDFEKYWPADMHMTAKEIVRFHSIVWPIILMMLDLPLPKHLYGHGWINFNGDKMSKS
KGNVVDPFVLCERYGVDAVRYQILRDMPYGSDCNFTNELMLTRINADLANDLGNLVSRTV
AMADKYFGGTLPTDRASDELDNQLIGMAQSLCDTVTPLIEQAQHSKALEEIFKVISRANK
YIDETAPWVLAKDESNNARLATVLYNLLETIRICSALLSPFMPATMPEVWEQIGAGAEDT
AFDKLGTFGVLRADVTVKKGRVLFPRIDIKSEITELERLMKPKTVIKEDEDLDKAGIISI
DDFAKVKLRTGEITACEKIKKSKKLLKIQVDDARCGRQIVSGIAEYYTPEELIGKKIIFV
ANLAPAKLCGEESNGMLLACDAGDKVQVVFLDKDTPNGSTVR
NT seq 1929 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagacatattatttaaccacaccgatatattacccctccggtaatccccacata
ggtcactgttacacaacggttgcgtgtgacacgatagcacgcttcaagagaatgcagggc
tatgacgtaatgttccttacaggcacggacgagcacggtcagaagatagagcttaaagcc
gccgaaaagggcgttacccccaaggaatacgttgacgagatagtagccaacttcaagcgt
ctttgggaaacaatgcacataagctatgaccgtttcatcagaacaacggacgactatcat
atagaaaccgtacagaagatattcaggaagctgtacgaaaagggctacatctataaaggc
acctacaagggcaaatactgcacaccgtgcgagagcttctggacagagagccagcttgta
gacggaaagtgtcccgactgcggacgtgaggtaaaagaagcaaacgaagaagcatacttc
ctccgcctttccgattttgccgacaagattgaaaagttccttaccgaaaccgactattta
cagcctaagagccgtgtaaacgaaatggtaaacaacttcataaagccgggccttgaggat
ctgtgcgtatcaagaaccagctttacctggggcatacccgttgattttgacagcaagcac
gttgtttatgtatgggtagacgcactttcaaactatatcagtgcgctcggctacggcaac
gagaagtacaatgattttgaaaaatactggcccgcagatatgcacatgaccgctaaggaa
attgtacgtttccactctatcgtatggcctataatccttatgatgctcgatctgcccctg
cccaaacacctttacggtcacggctggataaatttcaacggcgacaagatgagcaagtca
aagggcaacgttgtagacccgtttgtgctttgcgagcgttacggcgttgacgctgtacgt
tatcagatactgcgtgatatgccctacggcagtgactgcaacttcacaaatgaacttatg
ctcacaagaataaacgcagaccttgcaaacgatctcggaaaccttgtttcaagaacagta
gcaatggcagacaagtatttcggcggaacactgcccacagacagagcttccgacgagctt
gacaatcagcttatcggtatggctcagtcgctgtgcgatacggttactccccttatcgag
caggctcagcactcaaaggcgcttgaggaaatattcaaggtaatctcccgtgccaacaag
tatatcgacgaaactgcaccgtgggtacttgcaaaggacgaaagcaacaacgcccgtctt
gcgaccgtactctataacctgcttgaaactattcgtatctgctcggcactgctcagcccc
tttatgcccgcaacaatgcctgaggtatgggagcagataggcgcaggtgcagaagatacc
gctttcgacaagctcggcacattcggcgttctgcgtgcagacgttacggtaaagaagggc
agagttctcttccccagaatcgacataaagagcgagattacagaacttgaacgccttatg
aagcccaagactgtaatcaaggaggacgaggatcttgacaaggcaggaataatctctata
gatgactttgcaaaggtcaagctcagaacaggcgagattacagcctgcgaaaagataaag
aagtcaaagaagctgcttaaaattcaggtggacgatgcaagatgcggcagacagatagta
tcgggcattgccgaatactacactcccgaggagcttatcggaaagaaaattatattcgtt
gcaaatcttgcccccgcaaagctctgcggcgaagaaagcaacggtatgctccttgcctgt
gacgcaggagacaaggtacaggtagtattcctcgacaaggatacacccaatggcagtaca
gtaagataa

DBGET integrated database retrieval system