KEGG   Escherichia sp. E4742: FEM44_04195
Entry
FEM44_04195       CDS       T06276                                 

Gene name
xdhA
Definition
(GenBank) xanthine dehydrogenase molybdenum-binding subunit XdhA
  KO
K00087  xanthine dehydrogenase molybdenum-binding subunit [EC:1.17.1.4]
Organism
esz  Escherichia sp. E4742
Pathway
esz00230  Purine metabolism
esz01100  Metabolic pathways
esz01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:esz00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    FEM44_04195 (xdhA)
Enzymes [BR:esz01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     FEM44_04195 (xdhA)
SSDB
Motif
Pfam: Ald_Xan_dh_C2 Ald_Xan_dh_C
Other DBs
NCBI-ProteinID: QCT86489
Position
877925..880222
AA seq 765 aa
MEAREATATGESCMRVDAIAKVTGRARYTDDYVMAGMCYAKYVRSPIAHGYAVSINDEQA
RSLPGVLAVFTWEDVPDISFATAGHAWTLDENKRDTADRTLLTRHVRHHGDAVAIVVARD
ELTAEKAAQLVHIEWQELPVITTPEAALAEDAAPIHRGGNLLKQSTMSTGNVQQAIDAAD
YQVQGHYQTPVIQHCHMESVTSLAWMEDDSRITIVSSTQIPHIVRRVVGQALDIPWSCVR
VIKPFVGGGFGNKQDVLEEPMAAFLTSKLGGIPVKVSLSREECFLATRTRHAFTIDGQMG
VNRDGTLKGYSLDVLSNTGAYASHGHSIASAGGNKVAYLYPRCAYSYSSKTCYTNLPSAG
AMRGYGAPQVVFAVESMLDDAAEALGIDPIEIRLRNAAREGDANPLTGKRIYSAGLPECL
EKGREIFEWDKRRTECQNPQGNLRRGIGVACFSYTSNTWPVGVEIAGARLLMNQDGTINV
QSGATEIGQGADTVFSQMVAETVGVPVSDVRVISTQDTDITPFDPGAFASRQSYVAAPAL
RSAALLLKEKIIAHAAVMLHLSAMNLTLIKGHIVLVERPKEALLSLKDLAMDAFYHPERG
GQLSAESSIKTTTNPPAFGCTFVDLTVDIALCKVTINRILNVHDSGHILNPLLAEGQVHG
GMGMGIGWALFEEMIIDAKSGVVRNPNLLDYKMPTMPDLPQLESAFVEINEPQSAYGHKS
LGEPPIIPVAAAIRNAVKMATGVAINTLPLTPKRLYEEFHLAGLI
NT seq 2298 nt   +upstreamnt  +downstreamnt
atggaagcgcgggaagcaaccgctacaggtgaatcatgcatgcgcgtcgatgccattgcg
aaggtcaccgggcgggcacgatatactgacgattatgttatggcgggcatgtgttacgcg
aaatatgtacgtagcccaatagcacatggttatgcggtgagcattaacgatgaacaagcc
agaagtttaccaggcgtgctggccgtatttacctgggaagatgtccctgatatttccttt
gccacggcgggccatgcctggactctggatgagaataaacgcgatactgccgatcgcact
ctgttaacacgccacgtccgccatcatggagatgcggttgctattgtcgttgcccgtgat
gagctcacagcggaaaaagcagcgcaacttgttcacatcgaatggcaggaattacccgtc
attacaacgccagaagcggcactggcagaagacgctgcaccaatccatcgcggcggcaat
ttactgaaacaaagcacgatgtcgacagggaatgtccagcaagcaatcgacgccgccgac
taccaggtgcaggggcattatcagacgccggtcattcaacattgtcatatggaaagtgtg
acctcattggcgtggatggaagacgattcacgaattaccatcgtttccagcacccaaatc
ccgcatattgtccgccgcgttgtcggccaggcgctggatattccctggtcgtgcgtgcgg
gttatcaagccctttgtcggcggtggttttggtaataaacaagatgtactggaagagccg
atggcggcatttctgaccagtaaactcggcggcattccggtgaaagtttccctaagccgc
gaagaatgttttctggcgacccgcactcgccacgcttttaccattgacggacaaatgggc
gtcaaccgcgatggtacgctaaaaggctatagcctggatgttctgtctaacaccggcgct
tacgcttcacacggtcattccatcgcttctgcaggcggcaataaagttgcttatctctac
ccgcgctgtgcctattcttatagctcaaagacttgctataccaatctgccctcagcgggt
gcgatgcgtggttatggcgcaccgcaggtggtttttgctgttgaatctatgctggatgat
gctgccgaagcgctgggtatcgaccctatcgaaattcgtttacgcaacgccgctcgtgaa
ggcgatgcaaatccgctcacaggcaaacgcatttacagtgccggattaccagagtgcctg
gaaaaagggcgggaaatctttgaatgggataaacgccgtacagaatgccagaacccgcag
ggcaatctgcgccgcggcattggcgtcgcctgttttagctacacctctaacacctggcct
gtcggcgtagaaatcgcgggcgcacgcctgttgatgaatcaggatggcaccatcaacgtg
caaagcggcgcgacggaaatcggtcagggtgccgacacggtgttctcgcaaatggtagct
gaaaccgtgggcgttccggtcagtgatgtacgcgtaatttcgacgcaagataccgatatt
acgccattcgatcccggcgcatttgcctcacgtcagagctatgttgccgcgcctgcgctg
cgcagtgcggcactgttattaaaagagaaaatcatcgctcacgccgcagtaatgctgcat
ctgtcggcgatgaatctaaccctgataaaaggccatatcgtgctggttgaacgaccgaaa
gaggcgttactgtcgttaaaagatctggcaatggatgcgttttatcatcctgaacgtggc
gggcaactttctgccgaaagctcgatcaaaaccaccacgaacccacctgcgtttggctgt
acctttgttgatctgacagtcgatatcgcgctgtgtaaggtcaccatcaaccgcatcctc
aacgttcatgattcgggtcatattcttaatcctctgctggctgaaggtcaggttcacggc
gggatggggatgggcatcggctgggcgctttttgaagagatgatcatcgacgcgaaaagt
ggcgtggtgcgtaacccaaatttactggattacaaaatgccgaccatgccggatctgcca
caactggaaagtgcgtttgtcgaaattaatgaaccacaatctgcatacggacataagtca
ctgggtgagccgccaattattcctgttgccgctgcaattcgtaatgcggtgaagatggct
accggtgtcgcaatcaatacgctgccgctgacaccaaaacggttatatgaagagttccat
ctggcaggattgatttga

DBGET integrated database retrieval system