KEGG   Escherichia sp. E4742: FEM44_04205
Entry
FEM44_04205       CDS       T06276                                 

Gene name
xdhC
Definition
(GenBank) xanthine dehydrogenase iron sulfur-binding subunit XdhC
  KO
K13480  xanthine dehydrogenase iron-sulfur-binding subunit
Organism
esz  Escherichia sp. E4742
Pathway
esz00230  Purine metabolism
esz01100  Metabolic pathways
esz01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:esz00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    FEM44_04205 (xdhC)
SSDB
Motif
Pfam: Fer2_2 Fer2 Fer2_3
Other DBs
NCBI-ProteinID: QCT86491
Position
881108..881587
AA seq 159 aa
MNHSESITIECIINDMPFQLHAAPGMPLSELLREQGLLSVKQGCCVGECGACTVLVGGTA
IDSCLYLAAWAEGKQIRTLEGEAKGGKLSHVQQAYAKSGAVQCGFCTPGLIMATTAMLAK
PREKPLTITEIRRGLAGNLCRCTGYQMIVNTVLDCEETK
NT seq 480 nt   +upstreamnt  +downstreamnt
atgaatcacagcgaaagtattactattgaatgcatcattaacgatatgccttttcagctt
cacgccgcgccaggcatgccgctttcggaactgctccgcgaacaaggactgcttagtgtc
aaacaaggatgctgcgttggtgaatgcggtgcctgtacggtgctggttggcggaaccgcg
atagacagctgcttatacctggccgcatgggctgaaggaaaacagatccgcacgctggaa
ggcgaagcgaaaggcggcaaactttctcatgtacaacaggcttatgcgaaatctggcgct
gtacagtgtggtttttgtacgccggggcttattatggccactacggcaatgctggcaaaa
cctcgagagaaaccgttaaccattacggaaattcgccgtggtttggctgggaatctgtgt
cgctgtaccggatatcaaatgattgtgaatactgtcctggactgcgaagaaacgaagtaa

DBGET integrated database retrieval system