KEGG   Erwinia tasmaniensis: ETA_02460Help
Entry
ETA_02460         CDS       T00711                                 

Gene name
fadB
Definition
(GenBank) Fatty oxidation complex alpha subunit
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
eta  Erwinia tasmaniensis
Pathway
eta00071  Fatty acid degradation
eta00280  Valine, leucine and isoleucine degradation
eta00281  Geraniol degradation
eta00310  Lysine degradation
eta00362  Benzoate degradation
eta00380  Tryptophan metabolism
eta00410  beta-Alanine metabolism
eta00640  Propanoate metabolism
eta00650  Butanoate metabolism
eta00903  Limonene and pinene degradation
eta00930  Caprolactam degradation
eta01040  Biosynthesis of unsaturated fatty acids
eta01100  Metabolic pathways
eta01110  Biosynthesis of secondary metabolites
eta01120  Microbial metabolism in diverse environments
eta01130  Biosynthesis of antibiotics
eta01200  Carbon metabolism
eta01212  Fatty acid metabolism
Module
eta_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:eta00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    ETA_02460 (fadB)
   00650 Butanoate metabolism
    ETA_02460 (fadB)
  Lipid metabolism
   00071 Fatty acid degradation
    ETA_02460 (fadB)
   01040 Biosynthesis of unsaturated fatty acids
    ETA_02460 (fadB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ETA_02460 (fadB)
   00310 Lysine degradation
    ETA_02460 (fadB)
   00380 Tryptophan metabolism
    ETA_02460 (fadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ETA_02460 (fadB)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    ETA_02460 (fadB)
   00281 Geraniol degradation
    ETA_02460 (fadB)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ETA_02460 (fadB)
   00930 Caprolactam degradation
    ETA_02460 (fadB)
Enzymes [BR:eta01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     ETA_02460 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     ETA_02460 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     ETA_02460 (fadB)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     ETA_02460 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2
Motif
Other DBs
NCBI-ProteinID: CAO95292
UniProt: B2VFE1
Position
complement(291053..293239)
Genome map
AA seq 728 aa AA seqDB search
MLYQGETLSLDWLEDGIAELVFDAPGSVNKLDTQTVASLGEAISVLEQQPGLRGVLLSSR
KSAFIVGADIMEFLSLFAAPAERLTQWLAFANGIFNRLEDLPVPTVSAISGYALGGGCEC
VLATDFRIASTDTRIGLPETRLGIMPGFGGSVRLPRLLGADSALEIIAAGKDIDAMQALK
VGLVDAVVSVDKLHAAAVSMLKEAIAGKLSWRERRQLKLEPLKLSKIEAAMSFSTAKALV
LHTAGKHYPAPLTAVKTIEAAAGLRRDEALKLETAAFVPLARSDEARALVGIFLNDQAVK
AKAKKLTQGVAAPERAAVLGAGIMGGGIAYQSACKGTPIIMKDINENALMLGMSEAAKLL
NKQLARGKIDGLELASIMSTIQPALHYASFEQVDMVVEAVVENPQVKATVLAETERHIRP
DAILASNTSTIPIDRLAETLTRPENFCGMHFFNPVPRMPLVEVIRGAKTADATIAKAIAW
ASKMGKTPIVVNDCPGFFVNRVLFPYFAGFSLLLRDGADFRQIDKVMEKQFGWPMGPSWL
LDVVGIDTAHHAQNVMAEGFPARMKKEYRDAVDVLFAAKRYGQKNQRGFWRWETDSKGKL
KKVADDEIDGLLQSVCRPKRAFSDEDIVARMMIPMINEVVRCLDEGVIASPAEADMALVY
GLGFPPFRGGAFRYLDTQGSGNYLALAEPFTALGPLYQVPESIREKAAAGASWYSAAAPL
DNTLLRTA
NT seq 2187 nt NT seq  +upstreamnt  +downstreamnt
atgctctaccaaggcgaaaccctttccctcgactggctggaagacggcatagccgagctg
gtctttgatgcccccggctcggtgaataagctcgatacgcagaccgttgccagcctgggc
gaagccatctccgtgctggagcagcagccagggctgcgcggcgtgctgctcagctcgcgc
aaatcggcgtttatcgtcggtgccgatattatggaatttctgtcgcttttcgccgcgccg
gcggaacgactcacccagtggctggcgtttgctaacggcatctttaaccgacttgaggat
ctgcctgtgccaacggtatccgccatcagtggctacgcgttgggcggcggttgtgagtgt
gtgcttgctaccgattttcgtattgccagcaccgatacacgcattggcctgccggaaacc
agattaggcattatgccgggttttggcggctcggtacgcctgccacgcctgctgggcgct
gacagcgcgctggaaattattgccgccggaaaagatattgatgccatgcaggctttaaag
gtgggtctggtggatgccgtcgtcagcgtggataaacttcacgcggcggcggtttccatg
ctgaaagaagccattgcgggcaaattatcctggcgtgaacgtcggcagctcaagctggag
ccgttgaaactaagcaaaattgaggcagccatgagtttcagcaccgccaaagcgctggtg
ctgcacaccgccggtaagcactatccggccccgcttaccgccgtgaaaaccattgaggcg
gcggccggcttgaggcgcgacgaagccctgaagctggaaacggcggcttttgtgccgctg
gcgcgctctgatgaggcccgtgctctggttggcatcttcctgaatgaccaggccgtgaag
gccaaagcaaaaaaactgacgcaaggcgtcgcagcacccgagcgtgccgccgtgctgggt
gcaggcattatgggcggcggcattgcctatcaatctgcctgcaaaggcacccccatcatc
atgaaagacattaacgaaaacgcgctgatgctcgggatgagcgaagccgcaaagctgctc
aataagcagttggcgcgcggcaagattgatggcctggagctggccagcatcatgagtacg
attcagccagcgcttcactatgccagttttgagcaggtcgatatggtggtcgaagcggtg
gtggaaaatccgcaggtgaaggccaccgtgctggcagaaacagagcgtcatatccgcccg
gatgccatcctcgcctcgaatacttcgacaattccgatcgacaggctggctgaaacgtta
acccgcccggaaaatttctgcggcatgcacttttttaatcccgtaccacgtatgccgctg
gttgaagtgatccgtggtgccaaaacggcggatgccaccatcgccaaagcgatcgcctgg
gccagcaaaatgggcaaaacgcccattgtggttaacgactgtcccggcttctttgttaac
cgcgtactgttcccctactttgctggttttagcctgttactgcgcgatggggctgacttc
cgccagatcgacaaagtgatggaaaaacagtttggctggccaatggggccttcgtggttg
ctggacgtggtgggcattgataccgcgcatcatgcgcagaacgtgatggcagaaggattc
ccggcacggatgaagaaagagtaccgcgatgccgttgacgtcctgtttgcggcaaaacgt
tacgggcagaaaaatcagcggggattctggcgctgggaaaccgatagcaaaggaaagctg
aagaaagtcgccgacgatgaaatcgatggtctgctgcaaagcgtctgccgccccaaacgt
gcgttcagcgatgaggatatcgtggcccgcatgatgataccgatgatcaacgaagtggtg
cgatgcctggatgaaggcgtgatcgccagcccggcagaggccgatatggcgctggtgtat
ggtcttggcttccccccctttcgcggcggtgctttccgctatctggatacccaaggcagc
gggaattacctcgcgcttgcagaacctttcaccgcgctcggcccgctctatcaggtgccg
gaaagtatacgtgaaaaggccgccgcaggcgcgagctggtactccgcggcagccccgctg
gacaacacactattaagaaccgcgtga

DBGET integrated database retrieval system