KEGG   Erwinia tasmaniensis: ETA_06160
Entry
ETA_06160         CDS       T00711                                 

Definition
(GenBank) Conserved hypothetical protein
  KO
K11902  type VI secretion system protein ImpA
Organism
eta  Erwinia tasmaniensis
Brite
KEGG Orthology (KO) [BR:eta00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:eta02044]
    ETA_06160
Secretion system [BR:eta02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   ETA_06160
SSDB
Motif
Pfam: ImpA_N Ribosomal_60s Hpt
Other DBs
NCBI-ProteinID: CAO95662
UniProt: B2VH74
Position
679568..680587
AA seq 339 aa
MDLEALLAPITPDRPCGDNLEYDADYMAMDQASAGKAEQQFGDTIIPAEPADWNKVERLA
LDLLGRSKDLRVMLALTRAWTQLKGLSGYADGLHLIQQALLLYWQPLWPSLEEDGIEDPF
YRLNALAALGDKSALTAALRQASLLRYATDEISLRDASGLLDGSKTECPGYPGGRARLQD
ELARGGQPGIEAVVKISERLLTIRETLTERLGAGALPEMDQLLKTINSVAAACQATDLST
LIPAVETAASSATSAPAAAPGAQQHADWRSVQLSSRSDAQLMLEKVKQYFSQHEPSHPAP
LMIERVQRMIELDFMDIIRDLAPDGVHQLETIFGRRDHS
NT seq 1020 nt   +upstreamnt  +downstreamnt
atggatcttgaagcgctgctggccccgatcacgcctgaccgcccctgtggcgataacctt
gaatatgacgccgactacatggcgatggaccaggccagcgccggtaaagccgaacagcag
tttggcgataccatcattccggcggaaccggcggactggaacaaagtcgagcggctggcg
ctggatctgctggggcgcagcaaagatctgcgcgtgatgctggcgctgacccgcgcctgg
acccagctcaaagggttgagcggctacgccgacggcctgcatctgatccagcaggcgctg
ctgctttactggcagccgctgtggccgtcactggaagaggacggtatagaggacccattt
taccgcctcaacgcgctggcggcgctgggtgataaatcggcgctgaccgccgcgctgcgc
caggcttcgttgctacgctatgccaccgatgaaatcagcctgcgcgatgccagtgggctg
ctcgacggcagtaaaaccgaatgccccggctatcccggcggccgcgcccgcttacaggat
gaactggcgcggggagggcagcccggcattgaggcggtcgtcaagataagtgagcggtta
ctgactattcgcgaaactttgactgaacggctgggcgcgggggcgttgccggaaatggat
cagctgctgaaaaccataaatagcgtggctgccgcctgtcaggccaccgacctcagtacc
ctgatcccagcggttgaaactgccgccagcagcgccacgtctgcgccagccgccgcgcct
ggcgcacagcagcacgccgactggcgcagcgtacagcttagctcgcgcagcgatgcgcag
ctgatgctggaaaaagtgaaacagtattttagccagcacgagccaagccatcccgccccg
ctgatgatcgagcgcgtacaacgcatgatagagctggactttatggacattatccgcgat
ctcgccccggacggcgtacaccagctggaaacgattttcgggcgtcgcgaccactcatag

DBGET integrated database retrieval system