KEGG   Erwinia tasmaniensis: ETA_06170
Entry
ETA_06170         CDS       T00711                                 

Definition
(GenBank) Conserved hypothetical protein
  KO
K11901  type VI secretion system protein ImpB
Organism
eta  Erwinia tasmaniensis
Brite
KEGG Orthology (KO) [BR:eta00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:eta02044]
    ETA_06170
Secretion system [BR:eta02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   ETA_06170
SSDB
Motif
Pfam: T6SS_VipA
Other DBs
NCBI-ProteinID: CAO95663
UniProt: B2VH75
Position
680650..681186
AA seq 178 aa
MAVSKSSGQKFIARNRAPRVQIEYDVEIYGAERKIQLPFVMGVMSDLVGKPLEAQPGVDE
RKFLDIDVDNFDERMKALKPRVAFQAENTLTGEGRLNIDLTFNSMEDFSPDAVARNVEPL
NQLLDARTQLANLLTYMDGKNGAEELIGKILQDPTLLKSLSHLPKADDAPADDHGNKE
NT seq 537 nt   +upstreamnt  +downstreamnt
atggcagtcagtaaatccagtgggcaaaaattcattgcccgtaaccgcgcaccacgcgtg
cagattgagtacgacgtggaaatctatggtgcggaacgcaaaatccagctgcccttcgtg
atgggcgtgatgtccgacctggtcggcaaaccgctggaggcgcagccgggcgtcgatgaa
cgtaagtttcttgacatcgacgtcgacaacttcgacgaacgcatgaaggcgctgaagccc
cgcgtggcgttccaggcagaaaacaccctgaccggcgaagggcgtctcaacatcgatctg
accttcaacagcatggaagacttctcgccggatgcggtggcacgcaacgtcgagccgctt
aaccagctgctggatgcccgcacccagctggctaacctgctgacctatatggacggcaag
aacggcgcggaagagctgattggcaaaatcctccaggatccaacgctgctgaaatcactc
agccatctgccgaaagctgacgatgcgccagccgacgaccacggcaacaaggagtaa

DBGET integrated database retrieval system