KEGG   Erwinia tasmaniensis: ETA_06200Help
Entry
ETA_06200         CDS       T00711                                 

Definition
(GenBank) Conserved hypothetical protein
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
eta  Erwinia tasmaniensis
Pathway
eta03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:eta00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    ETA_06200
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:eta02044]
    ETA_06200
Secretion system [BR:eta02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   ETA_06200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_HCP
Motif
Other DBs
NCBI-ProteinID: CAO95666
UniProt: B2VH82
Position
683237..683719
Genome map
AA seq 160 aa AA seqDB search
MAIDMYLKVDGITGESKDSNHTGWIDVTSFSWGATQPGNMSVGGGGGAGKVNFNDLHINA
KIDKAVTALLKNCASGKHVGKVEVSVCKAGGTQIEYTRITLEDVLVTNVQFVGSDGDDTL
GVTYAFQAAKVKQQYWEQSTSGGKGAESSAGWNIKENKEA
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atggctattgatatgtatttgaaagttgacggtataaccggtgaatctaaagattctaac
cacaccggctggatcgatgtgacttctttctcctggggcgctacccagccgggcaacatg
tccgtaggcggcggcggcggtgccggtaaagtgaactttaacgatctgcacatcaatgca
aaaatcgataaggcggttaccgcgctgctgaaaaactgcgccagcggtaagcacgtaggc
aaagtcgaggtctccgtatgtaaagcgggcggcactcagattgagtacacccgtattact
ctggaagacgtgctggtcaccaacgtgcagttcgtcggttccgacggtgacgatactctg
ggcgtaacctacgcattccaggctgccaaagtgaaacagcagtactgggagcagagcacc
tccggcggtaaaggcgcagaaagcagcgctggctggaatattaaagagaataaagaagct
taa

DBGET integrated database retrieval system