KEGG   Erwinia tasmaniensis: ETA_10720Help
Entry
ETA_10720         CDS       T00711                                 

Gene name
dapE
Definition
(GenBank) N-succinyl-diaminopimelate deacylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
eta  Erwinia tasmaniensis
Pathway
eta00300  Lysine biosynthesis
eta01100  Metabolic pathways
eta01120  Microbial metabolism in diverse environments
eta01230  Biosynthesis of amino acids
Module
eta_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:eta00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    ETA_10720 (dapE)
Enzymes [BR:eta01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     ETA_10720 (dapE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28 Peptidase_M18
Motif
Other DBs
NCBI-ProteinID: CAO96118
UniProt: B2VE50
Position
complement(1195760..1196887)
Genome map
AA seq 375 aa AA seqDB search
MHCPVIELAQQLIRRPSLSPDDAGCQAILIARLQALGFTIETMNIGDTLNFWAWRGKGET
LAFAGHTDVVPTGDVTRWNNPPFEPTIRDGMLYGRGAADMKGSLAAMVVAAERFVANYPQ
HEGRLAFLITSDEEASATNGTVKVVEALMARHERLDYCLVGEPSSTEVVGDVAKNGRRGS
ITANLTIHGVQGHVAYPHLADNPVHRAMPALNELVATEWDKGNEFFPPTSMQIANVQAGT
GSNNVIPGDCFVQFNFRFSTELTDVMIQQKVQALLERHQLRYSIEWKLSGQPFLTSRGKL
VDAVVNAVEHYNEIRPQLLTTGGTSDGRFIARMGAQVVELGPVNATIHKVDECVKAADLQ
LLSRMYQRIMEQLVA
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgcactgtccggtcattgagctggcgcaacagcttattcgtcgcccttccctcagccct
gatgatgccggttgccaggccatcttgattgctcgactacaggcgctgggcttcaccatt
gagacgatgaatattggcgatacgcttaatttctgggcgtggcgcggcaagggggaaacc
ctggccttcgccggtcacaccgacgtggtgcccactggtgatgtcacgcgctggaacaat
ccaccgtttgaaccgactatccgcgacggcatgttgtacggccgcggtgcggccgatatg
aaaggttcgctggcggcaatggtcgttgccgctgaacgttttgttgctaactatccgcag
catgagggccgtctggcgtttttgatcacctcagatgaagaggcaagcgccactaacgga
acggtaaaagtggtggaagccctgatggcgcgtcatgagcgcctggattattgtctggtc
ggtgagccttccagcacggaagtggtgggtgacgtggcaaagaacggtcgccggggctcc
atcaccgctaatctgacgatccacggcgtacagggccatgtggcctatccccaccttgcg
gataacccggtacatcgtgccatgcccgcgctgaatgagctggttgccaccgaatgggat
aaaggcaatgaattcttcccgccaaccagtatgcagattgccaacgtgcaggccggtaca
ggcagcaataatgtcattcccggcgactgtttcgtccagttcaatttccgcttcagcacc
gaattgaccgatgtcatgatccagcagaaggtgcaggcgctgcttgaacgccatcagtta
cgctacagcattgagtggaaactctccggccagccgttccttacctcacggggcaagctt
gttgatgcggtggtcaacgcggttgagcactataatgaaatcaggccgcagctgctcact
accggcgggacctccgacgggcgctttattgcacgcatgggtgcacaggtggtagagctg
gggccggtgaatgccaccattcataaagttgatgagtgtgtgaaggccgctgatttgcag
ctgctcagccgcatgtatcagcggattatggaacagctggtcgcttaa

DBGET integrated database retrieval system