KEGG   Erwinia tasmaniensis: ETA_13710Help
Entry
ETA_13710         CDS       T00711                                 

Gene name
adhB
Definition
(GenBank) Zinc-containing alcohol dehydrogenase, long-chain
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
eta  Erwinia tasmaniensis
Pathway
eta00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:eta00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    ETA_13710 (adhB)
Enzymes [BR:eta01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     ETA_13710 (adhB)
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     ETA_13710 (adhB)
    1.1.1.-  
     ETA_13710 (adhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C TrkA_N F420_oxidored ADH_N_assoc Shikimate_DH ADH_zinc_N_2 NTP_transf_3 ApbA 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: CAO96417
UniProt: B2VFK4
Position
complement(1554552..1555607)
Genome map
AA seq 351 aa AA seqDB search
MKAARWHKAHDIRVEDIEEPRVSAGKVKIKIAWTGICGSDLHEYLAGPIFAPVGKPHKLS
HDEAPIVMGHEFSGLVVAVGNGVTKVKVGERVVVEPILSCRTCEACREGKYNLCTDLGFH
GLSGGGGGFSSFTVVDEHMVHPMPEGLSYEQGALVEPAAVALHAVRMSRLKAGDKAAVFG
AGPIGLLLIEALRAAGASEIYVVELSPQRAEKARELGANVVIDPGQQDAVATIRERSQGG
VNVAFEVTGVPVVLKQCIDSTRYEGETIIVSIWEGEASFHPNKVVLAERNVKGTIAYRHI
FPAVMELMTQGYFQAEKLVTKRIDLEDLVTEGFDTLVKEKNQVKILVRPPQ
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagcacgttggcataaagcccatgatattcgcgtggaagatatcgaagaacct
cgtgtcagtgcaggcaaagtgaaaatcaaaatcgcctggaccggcatctgcggcagcgat
ctgcacgagtatctggctggccctatctttgctccggtcggcaagccgcacaaattgagc
catgacgaagcgccgatcgtcatgggccacgagttttcgggtctggtcgtggcggtgggt
aacggcgtcaccaaggtgaaagtgggtgaacgggtggtggtcgagccaatcctctcctgc
cgcacctgtgaagcctgccgcgaaggaaagtataatctgtgcaccgacctcggttttcac
gggttatcgggcggcggcggcggtttttcctcctttacggtggtcgacgaacatatggtg
catcccatgccagaaggactctcgtatgagcagggtgcgctggttgagccggcagccgtg
gcactgcacgcggtgcggatgagtaggttaaaggccggagataaagcggcggtgttcggc
gcggggccgattggtctgctgctgatagaagcgctgcgcgcagcgggtgcctctgaaatt
tacgtggtggaactgtcgccgcagcgcgcggaaaaagcccgtgaactgggggcgaatgtg
gtcattgaccccggccagcaggatgcggtagccaccattcgtgaacggagtcagggcggg
gtaaacgtggctttcgaggtgaccggcgtgcccgtggtgctgaaacagtgcatcgacagc
acccgctacgaaggcgaaaccatcattgtttccatctgggaaggcgaagcatcattccac
ccgaataaagtggtgctggccgagcgtaacgtgaagggcaccattgcctaccgccatatt
ttccccgcggtgatggagctgatgacccagggatatttccaggccgaaaagctggtgaca
aaacgtatcgatctggaagacctggtgaccgaagggttcgacaccctggtgaaagagaag
aaccaggtgaaaattctggtgcgtccgccgcaataa

DBGET integrated database retrieval system