KEGG   Erwinia tasmaniensis: ETA_23810Help
Entry
ETA_23810         CDS       T00711                                 

Gene name
arnA
Definition
(GenBank) Bifunctional polymyxin resistance arnA protein (Polymyxin resistance protein pmrI) [Includes: UDP-glucuronic acid decarboxylase (EC 4.1.1.-) (UDP-GlcUA decarboxylase) (ArnAFT); UDP-4-amino-4-deoxy-L-arabinose formyltransferase (EC 2.1.2.-) (UDP-L-
  KO
K10011  UDP-4-amino-4-deoxy-L-arabinose formyltransferase / UDP-glucuronic acid dehydrogenase (UDP-4-keto-hexauronic acid decarboxylating) [EC:2.1.2.13 1.1.1.305]
Organism
eta  Erwinia tasmaniensis
Pathway
eta00520  Amino sugar and nucleotide sugar metabolism
eta01100  Metabolic pathways
eta01503  Cationic antimicrobial peptide (CAMP) resistance
Module
eta_M00761  Undecaprenylphosphate alpha-L-Ara4N biosynthesis, UDP-GlcA => undecaprenyl phosphate alpha-L-Ara4N
Brite
KEGG Orthology (KO) [BR:eta00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    ETA_23810 (arnA)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    ETA_23810 (arnA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:eta01005]
    ETA_23810 (arnA)
Enzymes [BR:eta01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.305  UDP-glucuronic acid dehydrogenase (UDP-4-keto-hexauronic acid decarboxylating)
     ETA_23810 (arnA)
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.13  UDP-4-amino-4-deoxy-L-arabinose formyltransferase
     ETA_23810 (arnA)
Lipopolysaccharide biosynthesis proteins [BR:eta01005]
 Unusual sugar
  ETA_23810 (arnA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd Formyl_trans_N Formyl_trans_C 3Beta_HSD NAD_binding_10 TrkA_N
Motif
Other DBs
NCBI-ProteinID: CAO97427
UniProt: B2VBI9
Position
complement(2685677..2687659)
Genome map
AA seq 660 aa AA seqDB search
MKAVVFAYHDIGCTGIRALAEAGYEIAAIFTHADNAAENHFFASVARTAAELGVPVYAPE
DANHPLWVDRIRGMKPDAIFSFHYRHMLNDDIINSASLGAFNLHASLLPKYRGRAPLNWV
LVNGEQETGVTLHRMVKRADAGAIIAQNTVAIADRDDALTLHRKVCAAAGELLAEALPAI
KIGEFSEHQQDESQASYVGRRTPEDGRIDWHLPAQRVYNLVRAVTDPWPGAFGYVGTGKF
IVWQSKIHYDRAAAKPGTVLSVAPFVVACAEGALEIVTGQSESGVYMQGSQLAQTLGLVA
GARLYNHPAAVAKRRTRVLILGVNGFIGNHLTERLLVDDNFEVFGLDIGSDAIGRFIGHE
RFHFVEGDISIHSEWIEYHIKKCDVVLPLVAIATPIEYTRNPLRVFELDFEENLKIIRDC
VKYKKRIIFPSTSEVYGMCTDASFDEDSSNLVVGPINKQRWIYSVSKQLLDRVIWAYGDK
EGLRFTLFRPFNWMGPRLDNLNAARIGSSRAITQLILNLVEGSPIKLIDGGRQKRCFTDI
HDGIEALFLIIENKQKNCDGQIINIGNPENEASIKQLAEQLLESFERHPLRDRFPPFAGF
REVESSTYYGKGYQDVEHRKPSIRNAKQLLNWQPTIAMDKTIDDTLDFFLQSVEPGDAEE
NT seq 1983 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgtggtatttgcctaccatgacattggttgcaccgggatccgtgcgctggcc
gaagccggttatgagatcgctgctattttcacccatgcggacaatgccgcagaaaaccac
ttttttgcttcggtagcacgtactgctgccgagttgggcgtgcctgtttatgcgcctgaa
gacgctaaccatccgttgtgggttgaccgtattcgagggatgaagccggatgcgatcttc
tcgttccactacaggcatatgctgaatgacgacatcatcaacagcgccagcctcggtgcc
ttcaatctgcatgcctcactgctgcctaagtatcgcggcagggcaccgctgaactgggtc
ctggtcaacggcgagcaggaaaccggcgtgacgctgcatcgcatggtgaagcgtgccgat
gcgggggccattattgcccagaatacggtggccatcgccgatcgtgacgacgccctgacg
ctgcatcgcaaagtctgtgccgcggcgggcgaactgctagccgaagcgctgccggccatt
aagatcggcgagtttagcgagcatcagcaggacgagagccaggccagctatgtgggtcgc
cgtaccccggaggatgggcgtattgactggcatcttcctgcccagcgcgtctacaacctg
gtgcgggcggtgaccgatccgtggccgggcgcttttggctacgtgggaaccggcaaattt
attgtctggcagtcgaaaattcactacgaccgtgcggccgcgaagccggggacggtgctc
tccgttgcgccattcgtggtagcttgcgctgaaggtgcgctggaaatcgttaccggacaa
agcgaaagcggcgtatatatgcagggcagtcagctggcgcagacgctgggtctggttgct
ggtgcccgactgtacaatcatcctgccgccgtggcgaaacgccgtacccgtgttttgatc
ctcggcgtgaacggttttatcggcaaccatctgaccgagcgccttctggtcgacgataac
tttgaagtgtttggcctggatattggttcagatgctatcgggcgctttatcggccatgaa
cgtttccatttcgtcgagggggatatcagcatccactcggagtggatcgaatatcacatt
aagaaatgtgacgttgtgctgccgctggtggcgattgccacgccaatagaatatacccgt
aacccactgcgtgtgtttgaactggatttcgaagaaaacctgaaaatcattcgcgactgc
gtgaaatataaaaagcgtattattttcccttccacgtctgaagtttacggtatgtgcacc
gacgccagcttcgatgaggatagctctaatctggtggtcgggccgatcaacaaacagcgc
tggatctactcggtatccaaacagctgcttgaccgggttatctgggcttatggcgataaa
gaagggctgcgctttaccctgttccgtccatttaactggatggggccacgtctggataac
ctgaatgcggctcgtatcggcagttcgcgcgcgattacccagctgatcctcaatctggtg
gaaggctcgccgatcaaactgatcgacggagggcgtcagaagcgatgctttaccgatatc
cacgacggtattgaagccttgttcctgattatcgagaacaagcagaaaaactgtgatggg
cagattatcaacattggtaatcctgaaaatgaagccagcatcaagcaactggctgaacag
ctgttggaaagttttgaacgccatccgctacgcgatcgtttcccaccgtttgccggtttc
cgcgaagtggaaagcagcacttactatggtaagggttaccaggatgtcgaacatcgtaag
ccttcaatccgcaatgcgaagcaactgctgaactggcagccgactatcgcgatggataag
accattgacgatacgcttgacttctttttgcaaagcgttgaaccaggggacgctgaagaa
tga

DBGET integrated database retrieval system