KEGG   Erwinia tasmaniensis: ETA_24050Help
Entry
ETA_24050         CDS       T00711                                 

Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
eta  Erwinia tasmaniensis
Pathway
eta00071  Fatty acid degradation
eta00280  Valine, leucine and isoleucine degradation
eta00310  Lysine degradation
eta00362  Benzoate degradation
eta00380  Tryptophan metabolism
eta00620  Pyruvate metabolism
eta00630  Glyoxylate and dicarboxylate metabolism
eta00640  Propanoate metabolism
eta00650  Butanoate metabolism
eta00900  Terpenoid backbone biosynthesis
eta01100  Metabolic pathways
eta01110  Biosynthesis of secondary metabolites
eta01120  Microbial metabolism in diverse environments
eta01130  Biosynthesis of antibiotics
eta01200  Carbon metabolism
eta01212  Fatty acid metabolism
eta02020  Two-component system
Brite
KEGG Orthology (KO) [BR:eta00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ETA_24050
   00630 Glyoxylate and dicarboxylate metabolism
    ETA_24050
   00640 Propanoate metabolism
    ETA_24050
   00650 Butanoate metabolism
    ETA_24050
  09103 Lipid metabolism
   00071 Fatty acid degradation
    ETA_24050
   00072 Synthesis and degradation of ketone bodies
    ETA_24050
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ETA_24050
   00310 Lysine degradation
    ETA_24050
   00380 Tryptophan metabolism
    ETA_24050
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ETA_24050
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ETA_24050
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ETA_24050
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:eta04147]
    ETA_24050
Enzymes [BR:eta01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     ETA_24050
Exosome [BR:eta04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ETA_24050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: CAO97451
UniProt: B2VBH8
Position
complement(2717414..2718598)
Genome map
AA seq 394 aa AA seqDB search
MNEVVVVSARRTATGAFMGGLSGLSAVALGSHVIRALLEESGVKASEISQVIMGQVLTAG
CGQNPARQSALKAGLPVETQCMTINKVCGSGLKSIHLGMQALLAGEATFVIAGGQESMSS
APHILTSSRTGTRLGNSEMKDSLVSDGLWDAFDDIHMGVTAENVADKFGITREMQDEFAL
LSHMKAIRAQEQDVFEREIVPVEWQNRKGETQRVDTDEGPRQTSIEKLEKLKPVFRKGGT
VTAGNASSLNDGAAAVLLCTRCTAEAQGLPVLASLGEFTNSGIKPALMGAGPIQAITDCL
TRSGWKPEDIEHLESNEAFAAQALAVIAQTGISPERINPYGGAIALGHAIGSSGCRILVT
LVHGLIRTNGQRGMAALCIGGGEGVALSVYRQKS
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaagtcgtggttgtttctgcaagacgcacggcaaccggtgcatttatgggggga
ctgtccgggctctccgccgttgcgctgggaagtcatgttattcgtgcgcttcttgaagag
tccggcgtcaaagcaagtgagatttcacaggtcattatgggacaggtattgaccgccggc
tgcggtcaaaaccccgcacgccagtctgcactgaaagccggactgcctgtcgaaacacag
tgtatgaccattaacaaagtctgcggttcgggtctgaaatcgattcatctgggtatgcag
gcactgctcgccggagaagcaacgtttgtgattgctggcggtcaggaaagcatgtccagt
gcaccgcatatcctgacatcgtcgcgtactgggacacgtctcggaaacagcgagatgaaa
gacagcctggtatctgatgggctctgggatgcttttgatgatatccacatgggggttact
gctgagaacgtggcggataagtttggtatcactcgtgaaatgcaggacgaattcgcgctt
ttatctcatatgaaggcaatcagggcgcaggagcaggacgtgtttgagcgcgaaattgtt
cctgtagagtggcagaacagaaagggtgaaactcagagggttgatactgatgaaggtccg
cgtcagaccagcatcgaaaagctcgagaaactcaaacctgtattcagaaaggggggcaca
gtcactgcgggtaatgcctcctcacttaacgacggtgccgccgctgttcttctgtgcacc
cgatgtacagcagaggcacagggactgccggttctggcttctttgggagagttcaccaac
tcgggtatcaagccggcactaatgggtgccggtccgatacaggcaatcacagactgcctt
actcgttcaggctggaagcctgaagacattgaacatctcgaatcaaatgaagcgtttgcg
gctcaggctctcgcagttatcgctcagacaggcatttcaccagagcgcatcaacccttac
ggtggtgctatcgcgcttggtcatgctattggatcgtcgggatgccgtatactggtcact
cttgtacacggtctgatacggaccaacggtcagcgcggcatggctgcactctgtattggc
ggtggcgaaggcgtcgcgttgagcgtctaccgacagaaaagctaa

DBGET integrated database retrieval system