KEGG   Erwinia tasmaniensis: ETA_28410Help
Entry
ETA_28410         CDS       T00711                                 

Definition
(GenBank) HAM1 protein homolog
  KO
K02428  XTP/dITP diphosphohydrolase [EC:3.6.1.66]
Organism
eta  Erwinia tasmaniensis
Pathway
eta00230  Purine metabolism
Brite
KEGG Orthology (KO) [BR:eta00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    ETA_28410
Enzymes [BR:eta01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.66  XTP/dITP diphosphatase
     ETA_28410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ham1p_like
Motif
Other DBs
NCBI-ProteinID: CAO97887
UniProt: B2VEZ3
Position
3167195..3167812
Genome map
AA seq 205 aa AA seqDB search
MKQQSGLTMQQVVLATGNPGKVRELADLLAAFGLDIVAQTALGVESAEETGLTFIENAIL
KARHASAVTGLPAIADDSGLAVDVLGGAPGIYSARYAGEEATDRQNLDKLLAALNAVPDG
ERQAHFHCVLVYLRHAADPTPLVFHGSWTGEIAHSAAGVGGFGYDPIFFVPELGKTAAEM
SKSEKLAVSHRGKALNLLLDAMKHG
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaacaatctggattgactatgcaacaagttgtactcgccaccggcaaccccggt
aaggtgcgtgagctggccgacctgctggccgcgtttggccttgatatcgtggcgcagaca
gcgctgggcgtagagtcagccgaagaaaccggtttgacctttattgagaacgccatcctg
aaggcgcgtcacgcttcagccgtcaccggactaccggcaattgccgacgattccggtctg
gcggtcgacgtccttggcggagcgccgggtatttattcagcccgctatgcgggtgaagaa
gcaaccgatcggcagaacctggacaaacttctggcggcgctgaatgccgtgccggacggc
gaacgccaggcgcattttcactgcgtactggtgtatctgcgccatgccgcagaccctacg
ccgctggtgttccatggcagctggacgggcgagattgcgcatagcgctgctggcgttggt
ggtttcggctacgatccgattttctttgtcccggagctgggtaagaccgcagccgagatg
agcaaaagcgaaaagctggccgtttcccatcgcgggaaggcgctgaacctgctgctggac
gcgatgaaacatggttaa

DBGET integrated database retrieval system