KEGG   Erwinia tasmaniensis: ETA_29750Help
Entry
ETA_29750         CDS       T00711                                 

Gene name
psd
Definition
(GenBank) Phosphatidylserine decarboxylase proenzyme
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
eta  Erwinia tasmaniensis
Pathway
eta00564  Glycerophospholipid metabolism
eta01100  Metabolic pathways
eta01110  Biosynthesis of secondary metabolites
Module
eta_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:eta00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    ETA_29750 (psd)
Enzymes [BR:eta01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     ETA_29750 (psd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase
Motif
Other DBs
NCBI-ProteinID: CAO98021
UniProt: B2VCV2
Position
3317594..3318493
Genome map
AA seq 299 aa AA seqDB search
MLDRIKLGLNHILPKKALTELAGWGAGKRGGRLTKAVIDAFVWYYKVDMKEAQKPDTASY
RTFNDFFVRPLRDEARPIETDPNQLVLPADGAISQLGPIEGDQIFQAKGHTYSLEALLAG
NAAMTDMFRDGEFVTTYLAPRDYHRVHMPCNGILREMIYVPGDLYSVNPLTAQNIPNLFA
RNERVICRFDTEFGPMVQILVGATIVGSIETVWSGTVTPPREGVIKRWSWPGADEEGAVV
LLKGQEMGRFKLGSTVINLFAPGKVKLAESLTAGSQTRLGATLATALQKESAEDVLHHP
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
gtgttagatcgtattaaactcggcctgaaccatatcttgcctaaaaaagccctgactgaa
ctggctggctggggtgccggtaaacgcggcggacggttaaccaaagccgtgatcgatgct
ttcgtctggtactacaaggttgatatgaaagaggcgcagaagcctgataccgccagctat
cgtaccttcaatgacttcttcgtgcgcccgctgcgcgacgaggcgcgcccgattgaaacc
gatcctaaccagctggttctgccggcggatggcgcgatcagccagcttggccccattgaa
ggcgatcagatttttcaggcgaagggccacacctactcgctggaagcgctgctggcaggc
aatgccgccatgaccgatatgttccgcgacggcgagtttgttaccacttaccttgcgcca
cgcgactatcaccgcgtgcatatgccttgtaacggtattctgcgtgagatgatctatgtg
ccgggcgatctctattcggtcaatcccttaacggcgcaaaatatccccaatctgtttgcc
cgcaatgagcgcgtcatctgccgcttcgatactgaatttggcccgatggtgcaaattctg
gtgggggcaaccatcgtcggcagcatcgaaaccgtgtggtcgggaaccgttacgccaccg
cgtgaaggcgtgatcaagcgctggagctggccgggtgccgacgaagaaggtgccgtggtg
ttgcttaaaggtcaggagatgggccgcttcaaacttggctccacggtgattaacctgttt
gcccctggcaaagtgaaactggccgaaagcctgaccgccggaagtcaaacccgtctgggc
gcaactctcgccactgcgttgcagaaagagagcgccgaagacgtccttcatcacccataa

DBGET integrated database retrieval system