KEGG   Erwinia tasmaniensis: ETA_30390Help
Entry
ETA_30390         CDS       T00711                                 

Gene name
fecE
Definition
(GenBank) Iron(III) dicitrate transport ATP-binding protein FecE
  KO
K23184  ferric citrate transport system ATP-binding protein [EC:7.2.2.18]
Organism
eta  Erwinia tasmaniensis
Pathway
eta02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:eta00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    ETA_30390 (fecE)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eta02000]
    ETA_30390 (fecE)
Enzymes [BR:eta01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.18  ABC-type ferric citrate transporter
     ETA_30390 (fecE)
Transporters [BR:eta02000]
 ABC transporters, prokaryotic type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Ferric citrate transporter
    ETA_30390 (fecE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran SMC_N AAA_21 AAA_16 AAA_29 AAA_23 AAA_5 AAA_33 Rad17 AAA_22 Mg_chelatase AAA_25 RsgA_GTPase NACHT AAA_14 AAA_30 AAA_15 AAA AAA_27 RNA_helicase ATPase_2
Motif
Other DBs
NCBI-ProteinID: CAO98085
UniProt: B2VCP1
Position
3396032..3396799
Genome map
AA seq 255 aa AA seqDB search
MPLILKELSAGYANKSVLHSLSLALPAGRITALLGPNGCGKSTLLRCCARLLTPQHGKVM
SGDKDLAALSARQLGQRLALLPQQHLAPEGVSVQELVGYGRSPWLNLFGRMGTRDRQLVQ
SAMEETQIAQLANRRVCELSGGQRQRAFLAMALAQDTPLLLLDEPTTWLDINHQIELMSL
LRIRQQQGKTVVAVLHDLNQASRYCDYLVLMSAGQVVASGTPEQVMTPALLQQVFSIRAE
IHPDPVSGRPMCVVL
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgccactgatcctgaaagagttgagcgccggatatgcgaataaatccgttctgcactct
ctctccctggcgctgccagcagggcgtatcaccgcgttgctcggccccaacggctgcggt
aaatcgacgctgctgcgctgctgcgcccggctgctgaccccgcagcacggaaaagtcatg
tcgggagataaggatctggccgcgttgtcagcccgccagctgggccagcgcctggcgcta
ctgccgcagcagcatttagcaccggaaggcgtcagtgtgcaggagctggtaggctatggc
cgcagtccgtggctgaatctgtttggccgcatgggcacgcgggatcgccagctggttcag
tccgcgatggaagaaacgcagatcgcccagctggctaaccgacgggtgtgcgaactctcc
ggcggccagcggcagcgggcctttcttgccatggcgctggcgcaggacacgccgctgctg
ctgcttgatgagccaaccacctggctggacatcaatcatcaaatcgagctgatgtcgctg
ctgcgtatacgacagcagcagggaaaaaccgtggttgcggtgttacacgatctgaatcag
gccagccgttactgcgactatctggttctgatgtccgcagggcaggtggtggccagcggc
acgcctgagcaggtgatgactcccgcgctgctgcaacaggttttctcaatcagagcagag
atccacccggacccggtttcaggacgcccgatgtgcgtggtgctgtag

DBGET integrated database retrieval system