KEGG   Erwinia tasmaniensis: ETA_30400
Entry
ETA_30400         CDS       T00711                                 

Definition
(GenBank) Conserved hypothetical protein
Organism
eta  Erwinia tasmaniensis
SSDB
Motif
Pfam: DUF4354
Other DBs
NCBI-ProteinID: CAO98086
UniProt: B2VCP2
Position
3396984..3397349
AA seq 121 aa
MAASVTVAGFCSVAHAAVPDNAAVYATEHSKGSMSIAGKDVYTKTFEVMVANLADKEFDL
STLCLKAVAPDHQEFKLDTVDEKLTTGKVKKGQSVKGIAVFASDNAAVQQTALVKLTDDC
K
NT seq 366 nt   +upstreamnt  +downstreamnt
atggcggcgtctgttaccgtagcgggtttctgcagtgtcgcgcatgcggccgtgcctgat
aatgcagccgtgtatgcgacagaacactctaagggatcaatgtcaattgccggcaaagat
gtctacacaaaaacctttgaagtgatggtggccaacctggctgataaagagttcgattta
tcaaccctctgtctgaaagcggttgccccggatcaccaggagtttaagctggatacggtt
gatgaaaagctcaccacgggcaaggtgaaaaaaggtcaatcggtcaaaggtattgctgta
ttcgcttcagataacgcggccgttcagcagactgcactagttaaattaacggacgactgc
aaataa

DBGET integrated database retrieval system