KEGG   Erwinia tasmaniensis: ETA_31510Help
Entry
ETA_31510         CDS       T00711                                 

Gene name
rplE
Definition
(GenBank) 50S ribosomal protein L5
  KO
K02931  large subunit ribosomal protein L5
Organism
eta  Erwinia tasmaniensis
Pathway
eta03010  Ribosome
Brite
KEGG Orthology (KO) [BR:eta00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    ETA_31510 (rplE)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:eta03011]
    ETA_31510 (rplE)
Ribosome [BR:eta03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    ETA_31510 (rplE)
  Bacteria
    ETA_31510 (rplE)
  Archaea
    ETA_31510 (rplE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L5_C Ribosomal_L5 DUF2862 AcetylCoA_hyd_C
Motif
Other DBs
NCBI-ProteinID: CAO98197
UniProt: B2VK52
Position
complement(3526711..3527250)
Genome map
AA seq 179 aa AA seqDB search
MAKLHDYYKDEVVKKLMTEFSYNSVMQVPRVEKITLNMGVGEAIADKKLLDNAAADLAAI
SGQKPFITKARKSVAGFKIRQGYPIGCKVTLRGERMWEFFERLISIAVPRIRDFRGLSAK
SFDGRGNYSMGVREQIIFPEIDYDKVDRVRGMDITITTTAKSDDEGRALLAAFNFPFRK
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaactgcatgattactacaaagacgaagtagttaaaaaactcatgactgagttt
agctacaattctgtcatgcaagtccctcgggtcgagaagatcaccctgaatatgggtgtg
ggtgaagcgatcgctgacaagaaactgctggataacgcagcagctgatttggcagcaatc
tccggtcaaaagccgtttatcaccaaagcacgcaagtcagttgcaggcttcaaaatccgt
cagggctatccgatcggctgtaaagtaactctgcgtggcgaacgcatgtgggagttcttt
gagcgtctgatttctattgctgttccacgtatccgtgacttccgtggcctgtccgctaag
tcattcgatggccgtggtaactacagcatgggcgttcgtgagcagatcatcttcccagaa
atcgactatgacaaagtcgaccgcgttcgtggtatggatatcaccattaccactactgcg
aaatctgatgatgaaggccgcgcactgttggctgcttttaacttcccgttccgcaagtaa

DBGET integrated database retrieval system