KEGG   Erwinia tasmaniensis: ETA_pET450190
Entry
ETA_pET450190     CDS       T00711                                 

Gene name
trbC
Definition
(GenBank) Probable F pilus assembly protein TrbC
  KO
K12059  conjugal transfer pilus assembly protein TrbC
Organism
eta  Erwinia tasmaniensis
Brite
KEGG Orthology (KO) [BR:eta00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:eta02044]
    ETA_pET450190 (trbC)
Secretion system [BR:eta02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   ETA_pET450190 (trbC)
SSDB
Motif
Pfam: TrbC_Ftype DUF1525
Other DBs
NCBI-ProteinID: CAO94963
UniProt: B2VB15
Position
pET45:13404..13922
AA seq 172 aa
MDFMKQKQAELKDFKEKLSGMNINIPQSQQSLVDKNSAEITSQQKQAVEENQEPKFIYFL
SFSIPNVGLLSMVNDAKKYGITPTMRGLVNNDFRETAKKSFELSKEDKDFGFIIDPFLFR
DYGINAVPAMVITCGEKHDLVYGSLPVKEALGKVAREGDCSEIAKKILAADK
NT seq 519 nt   +upstreamnt  +downstreamnt
atggattttatgaagcaaaagcaggcagaactaaaagattttaaagaaaaactgtcgggt
atgaatatcaatattccacagagtcagcagtctctggtagacaaaaacagcgcggagatc
accagccagcagaagcaggctgttgaggaaaaccaagagccaaaattcatatactttctg
agtttttccatacccaatgtaggcttgctaagtatggttaatgatgcaaagaaatatgga
attacgccgacaatgcgggggcttgttaataacgatttccgtgaaacggcaaaaaaatct
tttgagttgagtaaagaagataaagactttggatttataattgacccctttttgttccgt
gattatggcataaatgccgtgccagcaatggttattacctgtggcgaaaaacatgattta
gtgtatgggagccttccggttaaggaagcgctggggaaagttgccagagaaggtgattgt
agtgaaattgctaaaaaaattcttgccgcagataagtaa

DBGET integrated database retrieval system