KEGG   Erwinia tasmaniensis: ETA_pET450200
Entry
ETA_pET450200     CDS       T00711                                 

Gene name
traN
Definition
(GenBank) Conjugative transfer: aggregate stability
  KO
K12058  conjugal transfer mating pair stabilization protein TraN
Organism
eta  Erwinia tasmaniensis
Brite
KEGG Orthology (KO) [BR:eta00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:eta02044]
    ETA_pET450200 (traN)
Secretion system [BR:eta02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   ETA_pET450200 (traN)
SSDB
Motif
Pfam: TraN
Other DBs
NCBI-ProteinID: CAO94964
UniProt: B2VB16
Position
pET45:13930..15777
AA seq 615 aa
MFLASIIAFAGIAIHADADDMDAAFSAGSSISGNSKDQGNNALSQSGVTNTVPSATSNPA
EAGYYGGVKGSSSSLDSAKGSVPSTNEAYQSVSNADRSNPPPTIDPNADFIQNGVKNEAG
SASIVGSTNSHCTTNVVSKSVFQNYTCEKDLAELQTCARTGSITFTGSSHTETRTLKLQL
KNAYRDGNQVKVDFTFPDTATFISGSTQLVYTPAPYYSIPFDYYTKILGSSVTLQYGKSA
DSLSIAGVHADAGQTYSAVITMSTTSGSNSEAAYNTLIKYINDGTTVFHLDVTYQITVSD
KQAATTWAETCNFDKSTATASADSVCTDPGGTRTVTSEGQTYSQTQSCWQYSDSYVVPVT
STGNCSSLIADKNCTVAGRSCTDSQNGTCMHEQDTYQCQKTYTSEGQICGGNYFCQSGDC
GNTQASGDNEFGQIVAELAAVAAAGDDSKKTSPDISIFTGKAVVCRKAMANFENCCIDSG
WGGSVGLAHCNSEEKAIAEAKEKKVIIKVGAYCGTRVLGVCVQQKESYCQFEGKLAKIIQ
EQGRFKQLNISFGNSESPDCRGLTVDELQSVNFDKIDYADFYSEVQGNVKLPQNQETIDR
IKAKINNQVSNMGDQ
NT seq 1848 nt   +upstreamnt  +downstreamnt
ttgttcctcgcttctattattgcctttgcaggtatagcaattcatgctgatgctgatgat
atggatgctgcattcagtgcagggagtagtatatctggcaactctaaagaccaggggaat
aacgccctctctcagagtggagtaacgaataccgtaccttcagcaacatctaacccggca
gaagccggatactatggaggtgttaagggaagtagtagttcgctcgattcggctaaagga
tcagtaccgtcaacaaatgaggcttatcaatcagtctccaatgccgatagaagtaatccg
ccacctactatcgatccaaatgctgactttattcaaaatggtgttaaaaatgaagctggt
agcgcttcgatagttggcagcaccaacagtcactgcacaacgaacgtagtatctaagtct
gttttccagaattacacctgtgaaaaagatcttgccgagttgcagacttgcgcccgtaca
ggcagcattactttcacggggtcgagtcatacggaaactcgaacgctgaaattgcagctt
aaaaacgcatatcgtgatggaaaccaagtgaaggtagatttcactttccctgatacggca
acttttattagtggctctacacaacttgtctatacgccagccccgtattactcaatacca
tttgactattacacgaaaattctaggtagcagtgtgacacttcagtacggaaagagtgct
gattctttgagtatcgcaggcgtacatgcagatgctgggcaaacatactcagcggttatc
acgatgagcactacttcaggaagtaacagcgaagcggcgtataacacgctgattaaatat
attaacgatggcacgactgtatttcatcttgacgtgacatatcagattaccgtttcagac
aaacaggccgcaacgacctgggcggaaacctgcaacttcgacaaatctactgctactgca
tccgccgattcagtctgcaccgatccgggggggactcgcactgtgacttcagaaggtcag
acctattcgcagacgcagagctgctggcaatactcggattcatacgttgtacccgttaca
tcaacgggtaattgtagttcgttgattgcagataagaactgcacggtcgcgggacgcagt
tgtactgattcacagaatggaacctgtatgcacgagcaggatacctaccagtgtcagaaa
acatacacttccgaggggcagatttgcggtggcaactacttctgtcagtctggtgactgt
ggtaacacgcaggcaagcggtgataatgaattcggacaaattgtagccgaactggctgct
gttgccgctgcgggtgatgacagcaagaaaacttcaccagacatcagtatttttaccgga
aaggccgtggtgtgtcgtaaggcaatggcaaattttgaaaactgctgtatcgatagcgga
tggggcggtagtgtaggacttgcacactgtaattctgaagaaaaagcaattgcagaagcg
aaagagaaaaaagttattatcaaagtcggcgcatattgcggaacccgcgtattaggtgtg
tgtgtacagcaaaaagagtcatactgtcagtttgaggggaaactggcaaaaataattcag
gagcaaggaagatttaagcaacttaatatttcctttggtaattcggaaagtccagattgc
cgtggcctgactgttgatgaattacagtcagttaacttcgacaaaatagattatgccgat
ttttattctgaagttcaggggaatgtgaaactccctcaaaatcaggagacaatagatcgc
attaaagctaaaataaacaatcaggttagtaatatgggggaccagtaa

DBGET integrated database retrieval system