KEGG   Erwinia tasmaniensis: ETA_pET450210
Entry
ETA_pET450210     CDS       T00711                                 
Symbol
traF
Name
(GenBank) TraF protein
  KO
K12057  conjugal transfer pilus assembly protein TraF
Organism
eta  Erwinia tasmaniensis
Brite
KEGG Orthology (KO) [BR:eta00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:eta02044]
    ETA_pET450210 (traF)
Secretion system [BR:eta02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   ETA_pET450210 (traF)
SSDB
Motif
Pfam: TraF
Other DBs
NCBI-ProteinID: CAO94965
UniProt: B2VB17
Position
pET45:15777..16565
AA seq 262 aa
MARCALVGFISACFVFSNMVMADEVIDGEKPFTGWHWYNEPVNKYEAKKNEKPKSDIADI
SKMPIQEQVKVLQGYTKDALATAILYPHDIEANASFQRWQKFWTDHAGYFSQAFSVAQLK
YPDLDYNLEHSHYNSIASLESAKQQSNEDKAIQKIAENYGLFLFYRGSDPVDTQMAGVVS
AFAKAKNISIVPISVDGVVASTLPETRPDTGQSKAMRITHYPALYLVEPKSRKYEPVAYG
FMTQDDLATRFMYVATGFKPNF
NT seq 789 nt   +upstreamnt  +downstreamnt
atggctaggtgtgctctcgttggttttatttctgcgtgttttgttttttcaaacatggtg
atggcagatgaagttattgatggtgaaaaaccttttacgggctggcactggtataacgag
ccagtcaataaatatgaggctaaaaaaaatgaaaagccaaaaagtgacattgccgatata
agcaaaatgccgattcaggaacaggttaaggttttacaaggatatacaaaggatgcgctg
gcaacggccatcctttatccacacgatatagaggcgaatgcatcatttcagcgctggcaa
aaattctggacagatcacgcgggttatttttcacaggcgttttctgtagcgcagcttaaa
tatcctgacctggactataaccttgaacacagccattacaattctattgccagtctggaa
tcagctaaacagcaaagtaatgaagataaggcaattcagaaaatagccgagaattacggc
ctgtttctcttttatcgaggaagcgacccggtggatacacagatggcgggtgtagtttcc
gcattcgcgaaggcaaaaaatatttccatcgttccaatcagcgttgatggcgtggtcgca
agcacgctgccggaaactcgcccggacaccgggcagtcaaaagcgatgcgcattacgcat
taccccgcactttatctggttgaacctaaaagccggaaatatgagccagtggcctatggc
tttatgacgcaagacgatcttgccacccgctttatgtatgtagcaactggctttaaaccc
aacttctga

DBGET integrated database retrieval system