KEGG   Erwinia tasmaniensis: ETA_pET450280
Entry
ETA_pET450280     CDS       T00711                                 

Gene name
traI
Definition
(GenBank) TraI protein
Organism
eta  Erwinia tasmaniensis
SSDB
Motif
Pfam: TrwC AAA_30 TraI_2B TraI AAA_19 Viral_helicase1
Other DBs
NCBI-ProteinID: CAO94972
UniProt: B2VB36
Position
pET45:25322..31261
AA seq 1979 aa
MSVQTLSSSSGAAGYYSQADNYYFVGELLTGWHGKLAEEMGLSGSVDLKTFASLLDGITP
DGRKMGKNHRPGLDLTFSAPKSLSVLALVGGDERLIQAFQESVRDTITEIESFISTRVTK
DKQTSIETTGKGIFATFVHDTSRNLDPQLHMHVLTMNITEKNGKLYSLSSDNRYGNGFME
MVYTHHTLFGTIQRNILEKKVTTLGYQTRPTEKGLWEIQGVPVSLLGHFSSRSRDIRRAV
GDSASFSSRSIAALDTRSPKQVPDRSELLNEWNAAIRDHGFDMGEFISTAREQAQDGPAL
GHDDARPADAEQEQEQEQEQEQGGDTPSNPAPQQDEAAARQKQATPGTPAVRPEDTTQLA
QREHQAEKQPHMQTVSQKEKKPDAPPRNLEQDDRVIHTALSSLSNRKRDFSYTDVVLEIA
ASTENVVSLRYGEHLIDRAIETGKLIPLNDEKTRFTAQTLLIDEKVVVELARDHVANGLV
SGTKKPLENLLPELADRPVTIFTAPSTVRGVKAVIDKVISDQEDRGRSVTVLSPTASRRD
QIAFATEEKMIFRDLSEPETTFARNSTVIVDNAERMSARDSINLLSHARENNLQLVLINT
AGRSSQTNVLSLFEDGGASTGKVKTEHESLSVKVSHAPDKAQRGKDVASEYAAAFADTVR
PVVVAPTAQDRRQITDDIRASLKESGGIDGLAQGVMVEARNEVFMTIAEKKKVASWRTGY
VIEDRTERKPQVYTVGSIAEETKSLILYNDKGERSTVKASAMGRKDVRVFESTMIEVVPG
EVLKASAALKNQGIRAKDSLRVHEASGREITGFNERTGKEFTLYTQEPVYAAYGYVSGMG
EVNRAEGTVIAALSKRDLNANNINSLNMSGSSLSIYSPLDEKATVSKIQNMNLRNTVTEY
VISTAQKPDIDAATTYLKEHVATPMAIAVNRAIAGVQEVSVYATTLLSSALKLDRRLTAA
EVRNEIDSRIATGDLISLNGGTTTTDNPRVVPRATYEVEKDILGMVTAGYATKQPLVIRV
EEGKLDHLTAGQKGATGDILTGTDTFQFVQGFAGVGKTTKLTTLQSVLNELLPGLEIRGI
GPTHRAVGEMSGAGIHAQTAKSFVLDSLKDEANGVKQDHRNTLFIVDEASMVGNSDMRDT
LGLIDRAGGRAVVIGDRQQFLPIESGAPFQLAQERTPARLSVMQDIVRQTNLALREAVYS
TINGDHSGSLRQLEAISNDLVPRREVYRENPRFSGASLQGNASSSTVAEDYLSRTDEARA
GTMVITGTNKIRREINDLIQQGLVQDGSLSAARHVDVSVYSQILLPSTAFHDPDSWIRGR
VVINDSAYFRVEKVGNEGVTVRHMDSGLHQEWDYRGLDSTRMEMFDVEQTRFLEGDRVLL
RKTDIDTGKTSNEAYRIQAIRDNGQIVLEGKSGVRQIDPALTAQDRHIDLGYAVTSTGAQ
GASARYDIGFMGTEGAESRLTNARAYYILISRAKEHAQIYTDNTPAKLEAAIGINREPKH
TAHDLLHARKDASHAQTLSQFAASLDTFYAGRVLAESFSLDIGTSALKLLSRTPTAPLRV
MLPAYDYNGKVSGVNTWALAAARGEFSLGEQQTQTESNTLFSVVQRGNTPEVLSAGTLSD
ALTLAGKNPQASVILAPEGYEQHSVVLDVLNVDRITSTMIDEVTRFTEETPEQTVNADDL
PEPAQITADTTYDMPAENDTNNGQAIDTDMPDYGDMNGYDDAPEMDTDWQEYSDIMDDST
PELPDTDLPEPQAPTAPDTTLPELPGADLPELSLPEPDAPTAPDTTLPELPGADLPELSL
PEPDAPTVPGLPDTALPELPGADLPELSVPELATPTAPDVADNLPEYSVTELADTALPEL
SLPEPDAPTVPGLPDTALPELPGADLPELTVPELTVPGLSSMEGPDIALPAGEVSALSVG
DLTLPELNAPAPDISLPESAPESLDSITALGPDERENYDPTLRHDLGEFEISKTIDKDI
NT seq 5940 nt   +upstreamnt  +downstreamnt
atgtcagttcagaccctgtccagctcatccggcgcggcaggctattacagccaggcagac
aactattactttgtgggggaactgctgaccgggtggcacggtaagctggcggaagaaatg
gggctgtccggcagcgtggatttgaaaaccttcgccagcctgctggacggcataacgccg
gacggcaggaagatgggtaaaaatcaccgtcccggcctcgacctgacgttttccgcgccg
aaaagcctcagcgttctggcgctggtcggcggggatgagcgtcttatccaagcgttccag
gagtcggtgcgcgataccatcaccgaaattgaatcctttatctcgacccgcgtcacgaag
gacaaacagacgtcgatagagacgaccgggaagggcatttttgccactttcgtacacgat
accagtcgcaatctcgatccgcagttacacatgcacgtcctgaccatgaacattaccgag
aagaacggcaagctgtattccctgtcgtctgataatcgctacggcaacgggtttatggaa
atggtgtacacgcaccatacgcttttcggcacgattcagcgcaatatcctggagaaaaag
gtcacgacgctgggctatcaaacccggcccaccgaaaaagggctgtgggaaatccagggt
gttccggtaagcctgctggggcatttttcatcgcgcagccgcgatatccgccgtgcggtc
ggggattctgcttcattttcaagccgcagcattgccgcgctcgatacccgttcgcccaag
caagtgcccgaccgttcggaactgctgaacgaatggaacgccgccattcgcgatcacggc
tttgatatgggtgagttcatcagcaccgccagagagcaggcgcaggacggcccggcactg
ggccacgatgacgcccgcccggcagacgcggagcaggagcaggagcaggagcaggagcag
gagcagggcggcgatacgccaagcaaccccgcaccgcaacaggatgaagccgcagcgcgt
cagaaacaggcaacgcccggcactcccgcagtgcgcccggaagacacgacccaactggca
cagcgtgagcatcaggcggaaaaacagccgcatatgcagaccgttagccagaaggaaaaa
aaaccggacgcgccgccaagaaatctggagcaggacgaccgcgtgatccacacggccctg
tcttccctcagcaaccgcaagcgtgacttcagctataccgatgtggtgcttgagattgcc
gccagtaccgaaaacgtggtgtcactgcgatacggcgagcacctgattgaccgggccatc
gaaactgggaagctgatcccactgaacgatgagaagacccgattcaccgcgcagaccctg
ctgattgatgaaaaagtggttgtggaactggcccgcgaccacgttgccaatggcctggtg
tccggtactaaaaaaccgctggaaaacctgctgcccgaactggcagaccgccccgtgacc
atcttcactgccccctcgacggtgcggggcgtgaaggcggtgatcgataaggttatcagt
gaccaagaagaccgtgggcgcagcgtgacggtgctgtccccgactgccagccgccgcgat
cagattgcctttgcgaccgaagaaaaaatgattttccgcgacctgagcgagcctgaaacc
acgtttgcccggaactccacggtgatcgtggataacgccgagcggatgagcgcccgcgac
tcgattaacctgctgagccacgcacgggaaaacaacctgcaactggtgctgattaacacc
gcaggccgcagctcgcagaccaacgtgctgagcctgtttgaagacggcggggcgtcaacc
gggaaggtgaaaaccgagcatgaaagcctgagcgtgaaggtttcgcacgcgcctgataag
gcgcagcgcgggaaggacgttgccagcgagtacgcggctgcctttgccgacacggtgcgc
ccggtcgtcgtggccccgacggcgcaggacaggcgtcagattaccgacgatatccgtgcc
tcgctgaaggagagcggggggattgacggactggcgcagggcgtcatggtggaagcccgt
aacgaagtctttatgaccattgccgaaaagaaaaaggtcgctagctggcgtaccggatac
gtcattgaagaccgcaccgagcgcaagccgcaggtgtacactgtagggagcattgcggaa
gaaacgaagtccctgatcctctacaacgacaagggcgagagatcgaccgtcaaagcgtcc
gcaatggggcgtaaagacgtgcgcgtgtttgagtccaccatgattgaagtcgtgcccggc
gaagtgctaaaagcctctgccgcgctcaaaaatcagggtatccgggcgaaagacagcctg
cgcgtccatgaggcatccgggcgggaaatcactggctttaacgagcgcacgggcaaagag
ttcacgctttacacccaggaacccgtgtacgcggcctatggctacgtcagcggcatgggc
gaagtgaaccgcgccgaaggcaccgtgatcgccgcgctcagcaaacgcgacctgaacgcc
aacaacatcaattcactcaacatgtccggcagcagcctgtccatctattcgccgctcgat
gagaaggccaccgtcagcaaaattcagaacatgaacctgcgcaacacggtcacggagtac
gtgatcagcaccgcgcagaagccggacattgacgccgccaccacctacctgaaggagcat
gtggccacaccgatggccatcgcggtcaatcgcgctattgcgggcgtccaggaggtatct
gtttatgcgacaaccctgctcagcagcgccctgaaactggacaggcgtctgacggcggca
gaggtgagaaatgaaatcgacagccgcattgcgaccggcgacctgatcagcctcaatggc
ggcacgacgacgactgacaacccccgtgttgtaccccgcgccacgtatgaggtggagaaa
gacattttaggcatggtcactgccggatacgccaccaagcagccgctcgtcatacgcgtt
gaagagggcaagctcgatcacctgacggcaggccagaaaggggctacgggcgacattctg
acgggcacggacaccttccagttcgttcagggcttcgcgggcgtggggaaaaccaccaag
ctcaccacgctgcaatcggtgctcaatgagttgttacccggtctggaaattcgcgggatt
ggcccgacacaccgcgccgtgggcgaaatgtccggggctggcatccacgcacagacggca
aaatcctttgtactggactcactcaaggatgaagccaacggcgtgaagcaggatcaccgt
aacacgctgtttatcgtggatgaggccagtatggttggcaacagcgacatgcgcgacacg
ctgggcctgattgaccgtgccggaggccgtgccgtggtcatcggcgaccgacagcagttt
cttcccatcgagagcggagcaccgtttcagctcgcccaagagcgcacacctgcccgcctg
tccgtgatgcaggacattgtgcgccagaccaacctggcgctgcgtgaggccgtctacagc
acgattaacggcgatcacagcggcagccttcgccagctagaagccatcagcaacgacctg
gtgccgcgccgtgaggtataccgcgaaaatccgcgcttcagtggcgcgtcccttcagggc
aatgcctcatcctcgaccgtggcggaagattacctgagccgcaccgacgaggcccgcgcc
ggtacgatggtgatcacgggaaccaacaaaatcaggcgtgaaattaacgacctgatccaa
caggggctggtgcaggacggtagcctgtcagccgcccgccacgtcgatgtgtcggtgtac
tcacagatactgctacccagcacggcatttcacgatcctgattcgtggataagaggccgg
gtggtcatcaacgacagtgcttattttcgggtagagaaggtcggcaatgaaggcgtgacg
gtaaggcacatggacagcgggctgcatcaggaatgggactatcgcggactggacagcacg
cggatggagatgttcgacgttgagcaaacccgcttcctagagggggatcgcgtactgctg
cgcaaaacggatatcgacaccggaaagaccagcaacgaggcataccggattcaggccatc
cgcgataacgggcaaatcgtgcttgaaggcaaatccggcgtgcgccagatcgatccggcc
ttaaccgcccaggacaggcacattgacctgggctatgccgtgaccagtacgggcgcacag
ggggccagtgcccgctacgatatcgggtttatgggcactgagggcgcagagtcccgcctg
accaacgcccgcgcctactacatcctgatttcacgcgccaaagagcacgcgcagatttac
accgacaacacgcccgcgaagctggaggcggctataggcatcaaccgcgagccgaagcac
acagcccatgacctgctgcacgcccggaaggacgccagccacgcacagacgttgtctcag
ttcgccgcgtcactcgataccttctacgccgggcgcgtgctggcagagtcgttcagcctc
gatatcgggaccagcgcactgaagctgctttcccgcacgccgaccgcgccgctgcgcgtg
atgctgcctgcctatgactataacggcaaggtatccggtgtgaacacctgggcgcttgcc
gctgcgcggggcgagttcagcctgggcgaacagcagactcagaccgaaagtaacaccctt
ttcagcgttgtgcagcggggcaacacgccggaggtgctttcggcaggcacgctgtctgac
gccctgactcttgccgggaaaaacccgcaggccagtgtgattctcgcgccggaaggctat
gaacagcacagcgtggtgctcgatgtgctgaacgtggatcgtatcacatcaacgatgatt
gatgaggttacgcgcttcacagaagaaacacctgagcagacggtaaatgccgacgatctg
cctgagcctgcacagattacagccgataccacttatgacatgcccgctgaaaacgataca
aataacgggcaggcgattgatacggacatgccggattatggcgatatgaatggctacgat
gacgcgccggaaatggatacggactggcaggaatacagcgacataatggatgacagcacg
ccggaactgccggacaccgacctgccggagccgcaggcaccgaccgcgccggataccacg
ctgccggagctgccgggtgcagacctgccggaactgtcactgccggagccagacgccccg
accgcgccggataccacgctgccggagctgccgggtgcagacctgccggaactgtcactg
ccggagccagacgccccgaccgtgccgggcctgccagacaccgcgctgccggagctgccg
ggtgcagacctgccggaactttccgtgccggaactggcgacacccaccgcgccggacgtg
gcggacaacctgccggaatacagcgtgacggaactggcggacaccgcgctgccagagctg
tcactgccggagccagacgccccgaccgtgccgggcctgccagacaccgcgctgccggag
ctgccgggtgcagacctgccggaactgaccgtgccggaactgaccgtgccgggactcagc
agcatggaagggccagacattgccctgccagccggagaagtttcagccctgagtgtcggt
gatctaacgctgccggaactgaacgccccggcaccggatatcagcctgcctgagtccgcc
ccggagtcgttggacagcatcaccgcgctggggccggacgagcgggaaaattacgatcca
acgctcaggcatgacctaggtgaattcgaaatcagcaaaaccatagacaaggacatttaa

DBGET integrated database retrieval system