KEGG   Erwinia tasmaniensis: ETA_pET490070
Entry
ETA_pET490070     CDS       T00711                                 

Gene name
traC
Definition
(GenBank) TraC protein
Organism
eta  Erwinia tasmaniensis
SSDB
Motif
Pfam: DUF202 T4SS_pilin Tmemb_55A
Other DBs
NCBI-ProteinID: CAO94849
UniProt: B2VB01
Position
pET49:3593..3880
AA seq 95 aa
MNTRSGFLNAICLSLLFISMGVLAGGLDSGTDALTNIKTWIFAILGIAALIYLAYCIIWA
FMEKKSWSDVGVALLQVICAGGALVAGNWGLSLMA
NT seq 288 nt   +upstreamnt  +downstreamnt
atgaacacacgtagtggttttttaaatgctatatgtttatcactgctttttatctctatg
ggggttctcgctggggggctggacagtggtactgacgcattaacaaacattaaaacatgg
atatttgctatccttgggatcgcagcattaatttatcttgcttattgtattatatgggca
ttcatggaaaagaaaagctggagcgatgtgggcgtggcactattgcaagttatttgcgct
ggcggggcgttggtggctgggaactggggcttaagcctcatggcataa

DBGET integrated database retrieval system