KEGG   Erwinia tasmaniensis: ETA_pET490130
Entry
ETA_pET490130     CDS       T00711                                 

Gene name
traH
Definition
(GenBank) TraH protein
  KO
K03204  type IV secretion system protein VirB9
Organism
eta  Erwinia tasmaniensis
Pathway
eta03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:eta00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    ETA_pET490130 (traH)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:eta02044]
    ETA_pET490130 (traH)
Secretion system [BR:eta02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   ETA_pET490130 (traH)
Motif
Pfam: CagX DUF2118
Other DBs
NCBI-ProteinID: CAO94855
UniProt: B2VAV2
Position
pET49:8952..9713
AA seq 253 aa
MRKLFLALLIFSAVSTTSNAATFASGSSYDARMQTVMYNSDDVVKVRVKPGTVSVVQVSS
DEKIEDVGLGDPGAWNVSVRNNTLFFRPASEDNPDTNVVVVTDKRAYTLFLTSVKTNPTF
FLRFEYPKPKPILFDNNKIPCTDGGIVNGRYQVQGDESVKPNKIWDDGRFTCFTWENSKT
MPVVYRVDSDGNENLLNSSIEKDVMVVHDVSPEFLLRSGNQVMRVKTSSIVKRLYDKKGT
TTGQTRTEKITDE
NT seq 762 nt   +upstreamnt  +downstreamnt
atgcgtaaactttttttggccttactcatcttcagcgctgtatcaaccacttctaacgct
gctacgtttgccagcggctcatcatacgatgccaggatgcaaacagttatgtacaactcg
gatgatgttgtgaaagtgcgcgtaaagccgggtacggtttctgtcgttcaggtcagtagt
gatgaaaaaattgaagatgtggggctgggtgatcctggtgcgtggaacgtatcagtaaga
aataacacattatttttccgacctgcttccgaagataatcccgacacaaatgtcgtcgta
gtcactgataaacgcgcttacaccttatttctaacttctgtaaaaacaaatccaactttt
tttttaagatttgaatatccgaaacctaaacctatcttgtttgataacaacaaaattcct
tgcacagatggcggtattgtaaatggacgttatcaggtacaaggtgacgaatctgttaag
ccaaataaaatttgggatgatggtaggtttacctgttttacctgggaaaatagtaaaacg
atgccagtcgtttatcgtgttgattcagatggtaatgaaaacttgcttaatagcagcatc
gagaaagatgttatggttgttcacgatgtttctcccgaatttttactgcgaagtggtaat
caggttatgcgtgtaaaaacctcttctatcgttaagcgtttatacgataaaaaaggaacg
acaaccgggcagacaagaacggagaaaattactgatgagtaa

DBGET integrated database retrieval system