KEGG   Erwinia tasmaniensis: ETA_pET490150
Entry
ETA_pET490150     CDS       T00711                                 

Gene name
traJ
Definition
(GenBank) TraJ protein
  KO
K03196  type IV secretion system protein VirB11 [EC:7.4.2.8]
Organism
eta  Erwinia tasmaniensis
Pathway
eta03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:eta00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    ETA_pET490150 (traJ)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:eta02044]
    ETA_pET490150 (traJ)
Enzymes [BR:eta01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     ETA_pET490150 (traJ)
Secretion system [BR:eta02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   ETA_pET490150 (traJ)
SSDB
Motif
Pfam: T2SSE AAA_29 G-alpha ABC_tran Mg_chelatase Zeta_toxin Sigma54_activat AAA_7 TniB AAA AAA_16 AAA_28 AAA_23 TrwB_AAD_bind AAA_22 Sigma54_activ_2 ATP_bind_1 AAA_19 FtsK_SpoIIIE AAA_5 AAA_30
Other DBs
NCBI-ProteinID: CAO94857
UniProt: B2VAV4
Position
pET49:10855..11874
AA seq 339 aa
MIEDNSDIARLYLEKTGIQALLNREGLTEVAINQPGRIWYEGREGWQFVEEPAANFENLK
HLAESLSTYSNLPQLNQSNPIASVILPDGERGQIIMPPATEPGCIAISIRKPSLQRFSIA
DYVNSGRFDNVRIAQKQTVELSDKQKKLYELYQKGDPKSLEKFIYEAVRERLNFLIVGGT
GSGKTTIAKAVADIFPPERRYATIEDVPEMQLPNHPNHIHLFYKKGVITAKTIIEACMRL
KPDHIFLAELRGDEAWSYLEALNTGHEGSISTIHANSTYASFSRLASIVKQSCVGMTVDM
ELIMRTIKTSVDVILFFNHTHMTEIYFEPQEKNKLLNKM
NT seq 1020 nt   +upstreamnt  +downstreamnt
ttgattgaagataattctgatatagcgcgcctttatctggaaaagacaggtattcaagcg
ctgttgaaccgagaggggctaacagaggttgctatcaatcaacctggcaggatttggtat
gagggccgtgaaggatggcagtttgttgaggaaccggcagcgaattttgaaaacctgaag
caccttgcagaaagtctgtccacttactctaaccttcctcagttaaaccagtctaatccc
attgcttctgtgatccttcccgatggtgaaaggggccaaattattatgccgccagccacg
gaacccggctgtattgcgatttcaatacgtaaaccatctcttcagcgtttttctattgca
gactatgttaactctggtcgatttgacaatgtacgaatcgcacaaaagcaaacggtagaa
ctttcggacaagcagaaaaaattgtatgaactctatcaaaaaggtgacccaaaaagtctt
gaaaaattcatttatgaggcggttagagaaagacttaatttcctgattgtcggtggtaca
ggatcaggtaagacaacaatagcaaaagccgttgctgatatatttcctccagaaaggcga
tatgcaaccatcgaggatgttcctgaaatgcaattgcctaatcaccccaatcacattcat
ctgttttataaaaagggagttattaccgctaaaacaataattgaagcatgtatgcgcctg
aagccagatcatattttcctggctgaacttcgcggtgatgaagcctggagttacttagaa
gcattaaacacaggtcatgaagggtctatctcaaccattcatgcgaacagtacctatgct
tcattctcacgcctggcaagtatagttaagcagtcatgcgtgggtatgactgttgatatg
gaactgattatgcgaactatcaaaacatcggttgacgtgattttgttttttaatcatacg
catatgacggaaatctattttgagcctcaagagaaaaataaattattgaataagatgtaa

DBGET integrated database retrieval system