KEGG   Erwinia tasmaniensis: ETA_pET490160
Entry
ETA_pET490160     CDS       T00711                                 

Gene name
traK
Definition
(GenBank) TraK protein
  KO
K03205  type IV secretion system protein VirD4 [EC:7.4.2.8]
Organism
eta  Erwinia tasmaniensis
Pathway
eta03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:eta00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    ETA_pET490160 (traK)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:eta02044]
    ETA_pET490160 (traK)
Enzymes [BR:eta01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     ETA_pET490160 (traK)
Secretion system [BR:eta02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   ETA_pET490160 (traK)
Motif
Pfam: T4SS-DNA_transf TrwB_AAD_bind TraG-D_C XTBD ClpS
Other DBs
NCBI-ProteinID: CAO94858
UniProt: B2VAV5
Position
pET49:11900..13696
AA seq 598 aa
MSKIIGVSSILLLMFLASVVGGNYLGGYAALKYSGLNIDSLSANTFYEVISNYGGNPSYK
SLVGITWFGFGVPVVVFVAFCVLILFNLNPDKVIYGNSRLATDMDLAKSGFFPTLKQSKK
HKYPPILIGKMNKGRFKGQYIYYYGQQFLMLYAPTRSGKGVGIVIPNCLNYPESLVVLDI
KLENWFLSSGYRKKVMGQECYLFCPAGYVENEERAKAGEYRSHRWNPMDYVSRDALQRQT
DLRKIASVLYPLSGGDNDVWNTSAINLFIGLALYLIDKEHEAQENLTVSIAKVLKSATPG
GDLAAWMRKTLAKDAAVSTEARDYFEIFMAAPDKTRGSIMSNFTNGLDIFANPVTAAATS
ASDFNIRRLRKDKMSVYLGLTPDSLVTHKKLVNLFFSMIVNENTKELPEQNPELKYQVVL
LEDEFTSMGRVEIIQKSIAYTAGFNLRYVFILQNKGQMEDEKLYGKEGTETFIKNCAVEI
VYPPRDVDDAVKEISERIGVFDKKIKRKSKSDNRGSAGGSKSVADDVISSPVLLPDDIVA
LGKVKNKSETMKIREIILSEACYPFIADKIVYFEDPVFMGRVKIAKENHIEIPLLFNS
NT seq 1797 nt   +upstreamnt  +downstreamnt
atgagtaagataattggcgtatcatcaatacttttattaatgtttcttgcttcggttgtt
ggtggtaattatttaggtggttatgcagcgttaaaatattcaggcttaaatattgattca
cttagcgcgaatacattttatgaagtaataagtaattacggtggtaatccgtcctataaa
tcgctggttggtatcacatggtttgggtttggtgttccagtcgtcgtgtttgtggctttc
tgtgttctgatattgtttaaccttaatccagataaggttatctatggtaattcccgcctc
gctaccgatatggatttagcaaagtcgggttttttcccaaccctgaagcaatctaagaaa
cataaatacccgcctattcttatagggaaaatgaataaaggcagatttaaagggcagtac
atttattactatggtcagcagtttttaatgctttatgccccaacacgatccggtaaaggg
gtcggtattgttatccctaattgcctcaactatcctgaaagcctggttgtcctcgatatt
aaactggaaaactggttcctgtcgtcaggctaccgtaagaaagtaatgggccaggagtgc
tatctgttttgtcccgctgggtatgtggagaatgaggaaagggctaaggcaggggagtac
cgttctcatcgttggaatccgatggattacgttagccgcgacgcgctacagcgtcagacg
gacttacgtaagattgcatccgttctgtatcctctgagcggcggtgataacgatgtgtgg
aacacgtcagctataaacttgtttataggtcttgcactatatcttatcgataaagagcat
gaagcgcaggagaacctgacagtttccattgctaaggttttgaagtctgcaacgcctggc
ggcgatcttgctgcctggatgcgcaagactctcgcaaaggatgctgctgttagcacagag
gcccgggattattttgaaatctttatggctgcacctgataaaacgcgtggcagtattatg
agtaattttaccaatggtcttgatattttcgctaaccctgtaacggctgcggcgacaagc
gccagtgattttaatattcgtcgtttaagaaaagataaaatgtctgtttatcttggtctt
acgccggacagccttgtaacccacaaaaagctggtcaatcttttcttctccatgattgtt
aacgaaaacacaaaagaactgcctgagcaaaacccggagttaaaatatcaggttgtgcta
ttagaggatgagtttacgagcatggggcgagtggagatcattcaaaagtccattgcttac
actgctggttttaatctgcgttatgttttcattttgcagaataaagggcagatggaagat
gagaagctttatgggaaagagggtactgaaacttttattaaaaactgcgcagtagaaatt
gtttatcctccgcgtgacgttgatgatgcggtaaaagaaatatcagaacgcattggtgta
tttgataaaaaaatcaagcgaaaatccaaatctgataaccgggggagcgcaggcggttct
aagtctgtagctgatgatgttatatccagccctgtattacttccagatgatattgttgcg
cttggtaaggtaaaaaacaaaagcgagacaatgaaaattagggagatcatattaagcgag
gcttgctatccatttatcgctgataagattgtctatttcgaagatcccgtttttatgggg
cgtgtgaaaatagctaaggaaaatcacatagaaatacctctacttttcaattcataa

DBGET integrated database retrieval system