KEGG   Edwardsiella piscicida C07-087: ETAC_00005Help
Entry
ETAC_00005        CDS       T02509                                 

Definition
(GenBank) chromosomal replication initiator protein dnaA
  KO
K02313  chromosomal replication initiator protein
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ETAC_00005
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:etc03032]
    ETAC_00005
   03036 Chromosome and associated proteins [BR:etc03036]
    ETAC_00005
DNA replication proteins [BR:etc03032]
 Prokaryotic Type
  DNA Replication Initiation Factors
   Initiation factors (bacterial)
    ETAC_00005
Chromosome and associated proteins [BR:etc03036]
 Prokaryotic Type
  Nucleoid associated proteins
   Other nucreoid associated proteins
    ETAC_00005
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Bac_DnaA Bac_DnaA_C DnaA_N IstB_IS21 AAA Kinesin AAA_14 AAA_16 NACHT AFG1_ATPase ATPase_2 BLOC1S3 RNA_helicase AAA_19
Motif
Other DBs
NCBI-ProteinID: AGH72134
Position
1..1323
Genome map
AA seq 440 aa AA seqDB search
MWIRPLQAELSDNTLALYAPNRFVLDWVRDKYLNNINGLLNDFCGSDAPVLRFEVGSKPV
APAAVSSAASSGVSVAPAAVRTSSPARPSWERVTAQPELSYRSNVNPKHTFDNFVEGKSN
QLARAAARQVADNPGGAYNPLFLYGGTGLGKTHLLHAVGNGIMARKPNAKVVYMHSERFV
QDMVKALQNNAIEEFKRYYRSVDALLIDDIQFFANKERSQEEFFHTFNALLEGNQQIILT
SDRYPKEINGVEDRLKSRFGWGLTVAIEPPELETRVAILMKKADENDIRLPGEVAFFIAK
RLRSNVRELEGALNRVIANANFTGRAITIDFVREALRDLLALQEKLVTIDNIQKTVAEYY
KIKVADLLSKRRSRSVARPRQMAMALAKELTNHSLPEIGDAFGGRDHTTVLHACRKIEQL
REESHDIKEDFSNLIRTLSS
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgtggatccgtcctcttcaggcggagctcagtgacaacacgctggcgctgtatgcgccc
aaccgctttgttcttgattgggttcgtgataaatatttaaataatattaatgggttactt
aatgatttttgcggttccgatgcgccggtgctgcgttttgaggtgggcagtaagccggtc
gccccggctgcggtcagcagcgccgccagcagcggcgtgagcgtggcgccggccgccgtg
cgaaccagcagtccggcgcgcccgagctgggagcgggttaccgcccagccggagctctcc
tatcgctccaacgtgaatcctaagcacaccttcgataactttgttgagggtaagtctaac
cagctggcgcgcgcggcggcgcgtcaggtggcggataatccgggtggcgcttataacccc
ctgtttctatacggcggtaccggcctgggtaaaacgcacctgctgcatgcggtcggcaat
ggcatcatggcgcgtaagccgaacgccaaggtggtgtacatgcattcagagcgctttgtt
caggatatggtcaaagcgctgcagaataacgctatcgaagagtttaagcgctactaccgc
tctgtcgatgcgctgctgatcgacgatattcagttttttgccaataaggagcgctcacag
gaggagtttttccacaccttcaatgcgctgctggaaggcaatcagcaaatcatcctgacc
tccgaccgttatcctaaagagattaacggagtagaagatcgcctgaagtcgcgcttcggc
tggggactgacggtggccatcgagccgccggagctggagacgcgcgtcgctattctgatg
aagaaagccgatgaaaatgacattcgcctgccgggcgaggtggctttcttcattgccaag
cgcctgcgctcgaacgtccgcgagctggagggggcgctgaaccgggtgatcgccaatgcc
aacttcaccgggcgggcgatcaccattgattttgtccgcgaagcgctgcgtgacttactg
gcgctgcaggagaagctggtcaccatcgacaacattcagaagacggtggcggagtactac
aagattaaagtggccgacctgctgtccaagcgccgctcccgctccgttgcccgcccgcgc
cagatggcgatggcgttggccaaggagctgactaaccacagtctgccggagatcggcgat
gcctttggtgggcgggaccataccacggtgctgcacgcctgccgcaagattgagcagctg
cgcgaagaaagtcacgacatcaaagaagatttttctaatctaatcagaacgttgtcatcc
taa

DBGET integrated database retrieval system