KEGG   Edwardsiella piscicida C07-087: ETAC_00150Help
Entry
ETAC_00150        CDS       T02509                                 

Gene name
gmk
Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00230  Purine metabolism
etc01100  Metabolic pathways
Module
etc_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    ETAC_00150 (gmk)
Enzymes [BR:etc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     ETAC_00150 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_33 AAA_18 AAA_16 RsgA_GTPase ABC_tran AAA_22 CPT MMR_HSR1 Viral_helicase1 Rad17
Motif
Other DBs
NCBI-ProteinID: AGH72163
Position
complement(32811..33434)
Genome map
AA seq 207 aa AA seqDB search
MVQGTLYIVSAPSGAGKSSLIQALLKTQPTYDSRVSVSHTTRASRPGEQHGEHYYFVSVD
EFKAMIARDDFLEHAEVFGNYYGTSRQAIEKVLAQGIDVFLDIDWQGARQVRSKMPQARS
IFILPPSREELARRLHGRGQDSDDVIAGRMAKAVSEMSHYSEYDYLIINDDFDVALQDLR
TIIRAERLRRERQQLRHDALISKLLAD
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atggtacaaggtacgctctatatcgtttccgcgccgagcggcgctggcaaatccagcctg
atccaggccctgctgaaaacgcagccgacctacgactcccgggtttccgtctcgcacacc
acgcgcgccagccgtccgggcgaacagcacggtgagcattactactttgtctctgtggac
gagttcaaggcaatgatcgcccgcgatgatttcctggagcacgccgaagtctttggcaac
tactatggcacctcgcgtcaggcgattgaaaaggttctggcgcaggggatcgatgttttc
ctcgatatcgactggcagggcgcccgccaggtgcgcagcaagatgccgcaggcccgcagc
atcttcattctgccgccgtcgcgcgaggagctggcgcgccgtctgcacggtcgcgggcag
gacagcgatgacgtcatcgccgggcgtatggccaaggcggtcagcgaaatgtcgcactat
agcgagtacgactacctcatcatcaacgacgacttcgacgtcgcgcttcaggatctgcgc
accatcatccgcgccgaacgcctgcgccgcgagcgtcagcagctgcgtcatgatgcttta
atcagcaaattattggcagactga

DBGET integrated database retrieval system