KEGG   Edwardsiella piscicida C07-087: ETAC_00300Help
Entry
ETAC_00300        CDS       T02509                                 

Definition
(GenBank) acetolactate synthase 2 catalytic subunit
  KO
K01652  acetolactate synthase I/II/III large subunit [EC:2.2.1.6]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00290  Valine, leucine and isoleucine biosynthesis
etc00650  Butanoate metabolism
etc00660  C5-Branched dibasic acid metabolism
etc00770  Pantothenate and CoA biosynthesis
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01130  Biosynthesis of antibiotics
etc01210  2-Oxocarboxylic acid metabolism
etc01230  Biosynthesis of amino acids
Module
etc_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
etc_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    ETAC_00300
   00660 C5-Branched dibasic acid metabolism
    ETAC_00300
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    ETAC_00300
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    ETAC_00300
Enzymes [BR:etc01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.6  acetolactate synthase
     ETAC_00300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_N TPP_enzyme_C TPP_enzyme_M POR_N
Motif
Other DBs
NCBI-ProteinID: AGH72193
Position
62715..64364
Genome map
AA seq 549 aa AA seqDB search
MNGAQWVVQALRAQGVNQVFGYPGGAIMPLYDALYDGGVAHLLCRHEQGAVMAAIGYARA
SGRVGVCIATSGPGATNLITGLADAMMDSVPLVAITGQVASALIGTDAFQEMDVLGLSLA
CTKHSFMVTSLAELPEVMDRAFAIAMQGRPGPVLIDIPKDIQLAQGELATPLCSVASAQA
PCQPAALAQARAMLAQAQRPVLYVGGGVGMADAVPALRSLVSRSGMPVAATLKGLGAADD
RHPAYLGMLGMHGCKAANLAVQQCDLLIAVGARFDDRVTGRLDAFAPQAQVIHLDIDPAE
LGKLRQAHVSLCGDLNPLLSALTMPLDIAPWLQQVAALKAQHAWRYDHPGEAIYAPLFLH
QLSERKPPQAVVTTDVGQHQMWSAQHMQFSLPQDFITSSGLGTMGFGIPAAVGAQVARPD
DCVICVSGDGSFMMNVQELGTIKRARLPLKIVLLDNQRLGMVRQWQQLFFDARYSETDLS
DNPDFLTLAQAFDIPGQRISCKAQVAGALETLFSTPGPYLLQVAIDEFENVWPLVPPGAG
NESMLENVS
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atgaatggagcgcagtgggtagtacaagcgttacgtgcgcagggagtgaaccaggttttc
ggttatccgggcggtgcgattatgccgctgtacgatgcgctgtatgacggcggcgtagcc
catttgctgtgccgacacgagcagggcgcggtgatggcggcgattggctatgcccgcgcc
agcggccgcgttggtgtctgtatcgcaacctctggccccggcgccaccaacctgatcacc
ggcctggccgatgccatgatggactcggtgccgctggtggcgatcaccggacaggtcgct
tcggcgctgattggcaccgacgcatttcaagagatggatgtgctggggctgtcgctggcc
tgcaccaaacacagctttatggtgacgtcgctggccgagctgccggaggtgatggatcgc
gcgtttgccattgcgatgcaggggcgtccagggccggtgctgatcgatattcccaaagat
attcagctggcgcagggagagctggcgacgccgctgtgcagcgtagcgtcggcgcaggca
ccctgccagcccgcggcgttggcgcaggcgcgtgccatgctggcacaggcgcagcgaccg
gtgctgtacgtgggtggcggcgtagggatggccgatgcggtgccggcgctgcgctcgctg
gtgtcgcgcagcgggatgccggttgccgcgaccctaaaggggctgggcgccgccgatgat
cgtcaccccgcttacctggggatgctgggaatgcacggctgcaaggcggctaatctggcg
gtgcagcagtgcgatttgctgattgccgtcggtgcccgctttgacgatcgcgttaccggc
cgcctcgatgcctttgcgccgcaggcgcaggtgatccatctggatatcgatccggcggag
ctgggcaagctgcgccaggcgcacgtgtcgctgtgcggcgatctgaacccgctgctgtcg
gcgctgaccatgccgctggatatcgccccatggctacagcaggtggcggcgctcaaggcg
cagcatgcctggcgctatgaccatcccggcgaggcgatctatgcaccgctgtttttgcat
cagctctctgagcgtaagccgccgcaggcggtggtcaccaccgatgtcggacagcaccag
atgtggagcgcccaacatatgcaattttccctgccgcaggattttattacctccagcggg
ctggggaccatggggttcggcatcccggccgcggtcggcgcacaggtcgctcgccctgac
gactgcgtgatctgcgtctccggcgatggctctttcatgatgaacgttcaggagctgggc
accatcaagcgggccaggctaccgctgaaaatcgtgctgttggataaccagcgtctgggg
atggtgcgccagtggcagcagctgttctttgacgcccgctacagcgaaaccgatctctcc
gataatccggattttttaaccctggcgcaggcgtttgatatcccggggcagcgcatcagc
tgcaaggcgcaggtggccggggcgctggagaccctgtttagcaccccgggtccttatctg
ctgcaggtcgctatcgacgaatttgaaaatgtctggccgctggtgccgccgggcgcaggc
aacgaatctatgctggagaacgtatcatga

KEGG   Edwardsiella piscicida C07-087: ETAC_00305Help
Entry
ETAC_00305        CDS       T02509                                 

Definition
(GenBank) Acetolactate synthase small subunit
  KO
K11258  acetolactate synthase II small subunit [EC:2.2.1.6]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00290  Valine, leucine and isoleucine biosynthesis
etc00650  Butanoate metabolism
etc00660  C5-Branched dibasic acid metabolism
etc00770  Pantothenate and CoA biosynthesis
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01130  Biosynthesis of antibiotics
etc01210  2-Oxocarboxylic acid metabolism
etc01230  Biosynthesis of amino acids
Module
etc_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
etc_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    ETAC_00305
   00660 C5-Branched dibasic acid metabolism
    ETAC_00305
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    ETAC_00305
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    ETAC_00305
Enzymes [BR:etc01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.6  acetolactate synthase
     ETAC_00305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ACT_5 ACT_4
Motif
Other DBs
NCBI-ProteinID: AGH72194
Position
64361..64651
Genome map
AA seq 96 aa AA seqDB search
MMQSPSFQHHLAIQARRRPEILERVLRVVRHRGFEIHAMNMAQDGDCDSVSIELTVASTR
PVTLLSSQLSKLLDVARVDVSAPRSLRMLPRRQALG
NT seq 291 nt NT seq  +upstreamnt  +downstreamnt
atgatgcagagtccttccttccaacaccatctggctattcaggctcgtcgccgtccggag
atcctggagcgggtcctgcgcgtggtgcgccatcgaggctttgagatccacgccatgaac
atggctcaggacggcgactgcgatagcgtcagtattgagctgacggtggccagtacgcgg
ccggtcacgctgctgtcgtctcagttgagtaagctgctggacgtcgcgcgggttgacgtc
agcgccccgcgatcgctgcgcatgctgccccgccgtcaggcgctgggctga

KEGG   Edwardsiella piscicida C07-087: ETAC_03025Help
Entry
ETAC_03025        CDS       T02509                                 

Definition
(GenBank) acetolactate synthase large subunit
  KO
K01652  acetolactate synthase I/II/III large subunit [EC:2.2.1.6]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00290  Valine, leucine and isoleucine biosynthesis
etc00650  Butanoate metabolism
etc00660  C5-Branched dibasic acid metabolism
etc00770  Pantothenate and CoA biosynthesis
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01130  Biosynthesis of antibiotics
etc01210  2-Oxocarboxylic acid metabolism
etc01230  Biosynthesis of amino acids
Module
etc_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
etc_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    ETAC_03025
   00660 C5-Branched dibasic acid metabolism
    ETAC_03025
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    ETAC_03025
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    ETAC_03025
Enzymes [BR:etc01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.6  acetolactate synthase
     ETAC_03025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_N TPP_enzyme_M TPP_enzyme_C ROQ_II POR_N
Motif
Other DBs
NCBI-ProteinID: AGH72736
Position
703364..705082
Genome map
AA seq 572 aa AA seqDB search
MEMLSGAEMVVRSLIDQGVKHLFGYPGGTVLDIYDALHTVGGIEHILVRHEQGAVHMADG
YARATGQVGVVLVTSGPGATNAITGIATAYMDSVPLVVLSGQVPTSLIGNDAFQECDMVG
ISRPVVKHSFLVKQSEEIPAVLKKAFYLASSGRPGPVVVDLPKDILNPAQKYPYAYPQQV
SMRSYNPTCQGHRGQIKRGLQVLLAARRPVIYAGGGVIGAGCHEALRALAQQLNLPVTTS
LMGLGAFPASHPQSLGMLGMHGTYEANLAMHHADVIFAVGVRFDDRTTNNLAKYCPDATV
VHIDIDPSSISKTVTADIPIVGDAGDVLGALLTLLAQGDCRQDFDSLRDWWQRIEVWRDR
QCLRYVSDGQRIKPQQVIETLHRLTAGEAYVASDVGQHQMFAALYYGFDQPRRWINSGGL
GTMGFGLPAALGVRLALPQATVLCITGDGSIQMNIQELSTALQYDLPIVVVNLNNRFLGM
VKQWQDIIYAGRHSQSYMQSLPDFVRLAEAYGHVGIAIRSVDELETKLREALSIRDRLVF
VDVTVDETEHVYPMQIRGGAMNEMWLSKTQRS
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atggagatgttatcaggcgccgagatggtggtgcgatcgctgatcgatcagggcgtcaaa
cacctttttggctatccgggcggtaccgtgctggatatttatgacgccctgcatacggta
ggggggattgagcacattctggttcgtcatgagcagggggcggtgcacatggccgacggc
tatgcgcgggccaccgggcaggtgggcgtcgttctggtgacctccgggccgggggcgacc
aacgccattaccggtatcgcaacggcctatatggactccgtcccgctggtggtgctgtcg
ggccaggtccccacctcgctgattggcaatgatgcctttcaggagtgcgacatggtgggg
atctcccgtccggtggtcaagcacagcttcctggtgaagcagagcgaagagatccccgcg
gtgctgaagaaggcattttatctggccagcagcgggcgtcccggccccgtggtggtcgat
ctgcccaaggatatccttaaccccgcgcagaaatacccctacgcctatccgcagcaggtg
agcatgcgctcttataatccgacctgtcaggggcaccgggggcagattaaacgtggcctg
caggtgctgctggccgcccggcgcccggtgatctatgccgggggcggggtgatcggcgcc
ggctgccacgaggcgctgcgcgcgctggcgcagcagcttaatctgccggtgaccacctcg
ctgatggggctgggcgcctttccggcgtcacacccgcagagcctggggatgctggggatg
cacggcacctacgaagccaatctggcgatgcaccatgccgatgtcatttttgccgtcggc
gtccgctttgacgatcgcaccaccaacaatctggccaagtactgccccgatgcgacggtg
gtgcatatcgatatcgatcccagctcgatctccaagaccgtcacggcggatatccccatc
gtcggcgacgccggcgacgtcttgggggcgctgctcaccctgctggcgcagggcgactgt
cggcaggatttcgatagcctgcgcgactggtggcagcgtattgaggtctggcgcgatcgc
cagtgtctgcgctacgtcagcgacggtcagcggatcaagccacagcaggtgattgaaacc
ctgcaccgcctgacggcgggcgaggcctatgtggcctccgacgtcggtcagcatcagatg
ttcgccgcgctgtattacggcttcgaccaaccgcgccgctggatcaactccggcgggctc
ggcaccatgggctttggcttgccggcggcgctcggcgtacgcctggcgctgccgcaggcc
acggtgctgtgcatcaccggcgacggcagcattcagatgaatatccaggagctgtcgacg
gcgctgcagtacgatctgcccatcgtagtggtcaatctgaacaaccggtttttgggcatg
gtgaagcagtggcaggacattatctatgccgggcgtcactctcagtcctatatgcagtcc
ctgccggattttgtgcggctggccgaggcgtacggtcacgtcggtatcgcgattcgcagc
gtcgatgagctggagacgaagctgcgcgaggcgttgagcatccgtgaccggctggtgttt
gtcgacgtgacggtagatgagacggagcacgtgtacccgatgcagatccgcggcggggca
atgaatgaaatgtggctgagtaaaacccagaggagctga

KEGG   Edwardsiella piscicida C07-087: ETAC_03030Help
Entry
ETAC_03030        CDS       T02509                                 

Gene name
ilvH
Definition
(GenBank) acetolactate synthase 3 regulatory subunit
  KO
K01653  acetolactate synthase I/III small subunit [EC:2.2.1.6]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00290  Valine, leucine and isoleucine biosynthesis
etc00650  Butanoate metabolism
etc00660  C5-Branched dibasic acid metabolism
etc00770  Pantothenate and CoA biosynthesis
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01130  Biosynthesis of antibiotics
etc01210  2-Oxocarboxylic acid metabolism
etc01230  Biosynthesis of amino acids
Module
etc_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
etc_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    ETAC_03030 (ilvH)
   00660 C5-Branched dibasic acid metabolism
    ETAC_03030 (ilvH)
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    ETAC_03030 (ilvH)
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    ETAC_03030 (ilvH)
Enzymes [BR:etc01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.6  acetolactate synthase
     ETAC_03030 (ilvH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALS_ss_C ACT_5 ACT ACT_4 UvrB_inter
Motif
Other DBs
NCBI-ProteinID: AGH72737
Position
705085..705576
Genome map
AA seq 163 aa AA seqDB search
MRRILSVLLENESGALSRVVGLFSQRGYNIESLTVAPTEDATLSRMTIQTKGDAKVLEQI
EKQLHKLVDVLRVSELVPGAHVEREIMLVKLRASGYGREEVKRSTDIFRGQIVDVTASLY
TVQLAGTSDKLDAFLAAVREVAEIVEVARSGVVGVARGDKIMR
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgcggcggattttatcggtgttactggaaaatgaatccggcgcgctgtcgcgggtcgtc
gggctgttttcccagcgtggttacaatattgaaagtttgacggtggcgccgacggaggac
gccacgctatcgcggatgacgatccagaccaagggcgatgccaaggtgctggagcagata
gagaagcagctgcacaagctggtggatgtcctacgcgtcagcgagctggtgccgggggcg
cacgtggagcgtgagatcatgctggtcaagctgcgcgccagcggctacgggcgggaggag
gtcaagcgcagcaccgacattttccgtggccagatcgtcgatgtgacggcgtcgctgtat
acggtgcagctggccggtaccagcgataagctggacgcctttttggcggcggttcgcgag
gttgctgaaattgttgaagtcgcccgctcgggggtggtcggcgtggcccgcggcgataaa
atcatgcgctga

DBGET integrated database retrieval system