KEGG   Edwardsiella piscicida C07-087: ETAC_00310Help
Entry
ETAC_00310        CDS       T02509                                 

Definition
(GenBank) branched-chain amino acid aminotransferase
  KO
K00826  branched-chain amino acid aminotransferase [EC:2.6.1.42]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00270  Cysteine and methionine metabolism
etc00280  Valine, leucine and isoleucine degradation
etc00290  Valine, leucine and isoleucine biosynthesis
etc00770  Pantothenate and CoA biosynthesis
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01130  Biosynthesis of antibiotics
etc01210  2-Oxocarboxylic acid metabolism
etc01230  Biosynthesis of amino acids
Module
etc_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
etc_M00119  Pantothenate biosynthesis, valine/L-aspartate => pantothenate
etc_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    ETAC_00310
   00280 Valine, leucine and isoleucine degradation
    ETAC_00310
   00290 Valine, leucine and isoleucine biosynthesis
    ETAC_00310
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    ETAC_00310
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:etc01007]
    ETAC_00310
Enzymes [BR:etc01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.42  branched-chain-amino-acid transaminase
     ETAC_00310
Amino acid related enzymes [BR:etc01007]
 Aminotransferase (transaminase)
  Class IV
   ETAC_00310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_4
Motif
Other DBs
NCBI-ProteinID: AGH72195
Position
64704..65633
Genome map
AA seq 309 aa AA seqDB search
MTTKKADYIWFNGDMVPWGEARVHVMSHALHYGTSVFEGVRCYDTHRGPAVFRHREHMQR
LHDSARIYRMPLAYSVDELMAACRETLRRNQLSSAYIRPLVFIGDVGMGVNPPAGYSTDV
ILAAFPWGAYLGEEALEQGIDAMVSSWHRAAPNTIPTAAKAGGNYLSSLLVGSEARRHGY
QEGIALDVHGYVSEGAGENLFMVKNGVIFTPPFTSAALPGITRDAIITLAQAQGLEVREQ
VLSREALYLADEIFMSGTAAEITPVRSVDGIQVGIGRCGPITKRVQQAFFGLFNGQTEDR
FGWLDPVNP
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccaagaaagcggattatatctggtttaacggcgacatggtgccctggggcgag
gcccgagtacacgtgatgtctcacgccctgcactacggcacctcggtttttgagggggtg
cgttgctacgacacccaccgcggtccggcggtattccgccaccgtgaacatatgcagcgt
ctgcatgattcggcgcggatttaccgtatgccgctggcctacagcgttgacgagttgatg
gccgcctgtcgtgaaaccttgcgccggaatcagctgtcgagcgcctatatccgcccgctg
gtctttatcggcgacgtcggaatgggcgtgaatccacccgcgggctatagcacggatgtg
atcctcgctgctttcccctggggagcctatctgggggaggaggcgctggagcaaggcatc
gatgccatggtctcctcttggcatcgggccgcgcccaataccatcccaaccgcggccaag
gccgggggaaactatctctcttcgctgctggtgggatcagaggcgcggcgccacggttat
caggagggcattgcgctggatgtccacggctatgtatctgagggtgccggtgaaaacctg
tttatggtgaaaaacggggtgatcttcacgccgccctttacctccgccgccctgccgggg
atcacccgcgatgcgatcatcaccctggcgcaggcgcaggggctagaggtccgggagcag
gtgttgtcacgcgaggcgctgtacctggccgatgaaattttcatgtcgggcaccgcggcc
gaaatcacgccggtgcgcagcgtggacgggatccaggtcgggattggccgctgtggccct
atcaccaagcgggtacagcaggccttttttggcctgttcaacggccagactgaggaccgc
tttggctggctggatccggtgaatccgtaa

DBGET integrated database retrieval system