KEGG   Edwardsiella piscicida C07-087: ETAC_00315Help
Entry
ETAC_00315        CDS       T02509                                 

Definition
(GenBank) Dihydroxy-acid dehydratase
  KO
K01687  dihydroxy-acid dehydratase [EC:4.2.1.9]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00290  Valine, leucine and isoleucine biosynthesis
etc00770  Pantothenate and CoA biosynthesis
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01130  Biosynthesis of antibiotics
etc01210  2-Oxocarboxylic acid metabolism
etc01230  Biosynthesis of amino acids
Module
etc_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
etc_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    ETAC_00315
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    ETAC_00315
Enzymes [BR:etc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.9  dihydroxy-acid dehydratase
     ETAC_00315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ILVD_EDD
Motif
Other DBs
NCBI-ProteinID: AGH72196
Position
65735..67585
Genome map
AA seq 616 aa AA seqDB search
MPKYRSATTTHGRNMAGARALWRATGMTDADFGKPIIAVVNSFTQFVPGHVHLRDLGRLV
AAQIEAAGGVAKEFNTIAVDDGIAMGHGGMLYSLPSRELIADSAEYMVNAHCADAMVCIS
NCDKITPGMMMAALRLNIPVIFVSGGPMEAGKTKLSDRLIKLDLVDAMIQGANPQVSDAQ
SEQIERAACPTCGSCSGMFTANSMNCLTEALGLALPGNGSLLATHADRRALFEEAGRRIV
ALTRRYYEQDDASALPRSIAGKAAFENAMTLDIAMGGSTNTVLHLLAAAQEGEIDFTLAD
IDRLSRQVPHLCKVAPSTPDYHMEDVHRAGGVMGLLGELDRAGLLNRGVVNVLGLDLNET
LARYDIMRSDDEALRRLYSAGPAGLRTVEPFSQSCRWDALDRDRQHGCIRAREHAYSQDG
GLAVLSGNLAQDGCIVKTAGVDPESLIFRGPARVFESQEGAVEAILGGRIQPGDVLVIRY
EGPKGGPGMQEMLYPTAYLKSMGLGKQCALITDGRFSGGTSGLSIGHVSPEAASGGAIAL
VRDGDPIEIDIPARHIRIAIAESELALRRQQEQARGAQAWTPRDRRRAVSLALRAYASLA
TSADRGAVRDRAKLGG
NT seq 1851 nt NT seq  +upstreamnt  +downstreamnt
atgcctaagtatcgttctgccacgaccacccatggccgtaatatggccggtgcccgcgcg
ctgtggcgcgcgaccggaatgaccgacgcggatttcggcaagccgatcattgccgtggtg
aactcgtttacccagtttgtgccgggccatgtgcatctgcgcgatttgggccggctggtc
gccgcacagatcgaggccgccggcggcgtagcgaaagagtttaataccatcgccgtggat
gacggtatcgccatggggcacggcggcatgctctattcgctgccttcgcgggagcttatc
gccgactccgctgagtatatggtcaatgcccactgcgccgatgccatggtctgcatatcc
aactgcgacaagataacgccggggatgatgatggcggcgctgcgcctgaatatcccggtg
atttttgtctctgggggcccgatggaggccggtaaaaccaagctctctgatcggttgatt
aagctggatctggtcgatgcgatgatccagggcgccaatccgcaggtcagcgatgcacag
agtgaacagatcgagcgcgccgcctgcccaacctgcggctcctgctctgggatgtttacc
gcgaactccatgaactgcctgaccgaggcgctggggctggcgctgccgggcaacggttct
ctgctggcgacccacgccgatcgccgggcgctgttcgaggaggcggggcggcgtatcgtc
gctctgacccgccgctactatgagcaggatgatgcgtcggcgctgccgcgcagcatcgcc
ggcaaggcggcctttgagaatgccatgacgctggatattgccatggggggatcgaccaat
acggtgctgcatctgctggccgcggcgcaggagggggagatcgactttaccctggcggac
atcgatcgcctgtcgcgccaggtgccacacctgtgcaaggtcgcgcccagcacgccggat
taccatatggaggacgtacaccgcgcgggcggcgtaatggggctcctgggtgagctggat
cgcgcggggctgctcaatcggggcgttgttaacgttctggggctggatctgaatgaaact
ctggcgcgctacgacatcatgcgcagcgacgatgaggcgctgcgacgtctgtatagcgcc
gggcctgccgggctgcgtaccgtggagcctttttcgcagtcctgccgctgggatgcgctg
gatagggaccggcagcatggctgtatccgcgcgcgtgagcatgcctatagccaggatggg
gggctggcggtgctctcgggcaacctggcgcaggatggctgcatcgtcaagaccgccggc
gttgatcccgagagcctgatcttccgcggcccggcccgggtatttgaaagccaagagggg
gccgtcgaggcgatactcggcggacggatccagcctggcgacgtgctggtgatccgctat
gaaggccccaagggcgggccggggatgcaggagatgctctatcctaccgcctatctcaag
tcgatggggctgggcaagcagtgcgccctgatcaccgacgggcgcttttccggcggaacc
tccggtctgtccatcgggcatgtctcgccggaggccgccagcggcggcgccattgcgctg
gtgcgcgacggcgatccgatcgagatcgatattccggcgcgtcatatccgcatagccatt
gccgaaagcgagctggcgctgcgtcgccagcaggagcaggcgcgcggcgcacaggcgtgg
accccgcgcgaccggcgtcgtgcggtctcgctggccctgcgtgcctacgccagcctggcg
accagcgccgaccgcggcgcggtgcgcgatagagcgaagctgggaggctaa

DBGET integrated database retrieval system