KEGG   Edwardsiella piscicida C07-087: ETAC_00320Help
Entry
ETAC_00320        CDS       T02509                                 

Definition
(GenBank) threonine dehydratase
  KO
K01754  threonine dehydratase [EC:4.3.1.19]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00260  Glycine, serine and threonine metabolism
etc00290  Valine, leucine and isoleucine biosynthesis
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01130  Biosynthesis of antibiotics
etc01200  Carbon metabolism
etc01230  Biosynthesis of amino acids
Module
etc_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ETAC_00320
   00290 Valine, leucine and isoleucine biosynthesis
    ETAC_00320
Enzymes [BR:etc01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.1  Ammonia-lyases
    4.3.1.19  threonine ammonia-lyase
     ETAC_00320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Thr_dehydrat_C
Motif
Other DBs
NCBI-ProteinID: AGH72197
Position
67588..69132
Genome map
AA seq 514 aa AA seqDB search
MTSKPLISSAPDGAEYLRAVLRSPVYEVAQVTPLQAMEKLSGRLGNHILVKREDRQPVHS
FKLRGAYAMIAGLSEAQRACGVITASAGNHAQGVALSASRLGIAATIVMPRATAEIKVEA
VRGFGGRVLLYGANFDEAKAHAIQMAQETGMTFIPPFDHPAVIAGQGTLALELLQQDAHL
DRIFVPVGGGGLAAGVAVLIKQLMPQVKVIGVEAEDSACLRAALDAGQPVDLPRVGLFAE
GVAVKRIGDETFRLCQRYLDDVITVDSDAICAAVKDLFEDVRAVAEPSGALALAGLKQYV
QRHALRGERLAHVLSGANLNFHGLRYVSERCELGEQREALLAVTIPERKGSFLAFCQLLG
GRSVTEFNYRYADADSACIFVGVRLTNGRGEREEIIASLRGGGYQVVDLSDDEMAKLHVR
YMVGGRPSKPLQERLYSFEFPEAPGALLKFLHTLGTHWNISLFHYRSHGTDFGRVLAAFE
RPDSDASFEARLKELGYECHDETGNPAFRFFLQG
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgacgtcgaaaccccttatctcttcggcgccggacggcgcggaatacctgcgggcggtg
ctgcgctcgccggtgtatgaggtggcgcaggtcacgccgctgcaggcgatggagaagctt
tcaggccgcctgggtaaccatattctggtcaagcgcgaggatcgtcagccggtgcacagc
tttaagctgcgcggagcctacgcgatgatcgccgggctgagtgaggctcagcgggcctgc
ggcgtgatcaccgcctcagcgggaaatcatgcccagggcgtggcgctgtcggcgtcgcgg
ctggggatcgcggcgaccattgtcatgccgcgggcgacggcggagatcaaggttgaggcg
gtacgtggcttcggcggccgggtgctgctgtacggcgccaactttgatgaggccaaggcc
catgctatccagatggcgcaggaaaccggcatgacctttattccgcccttcgatcatcca
gcggtgatcgccggccagggaaccctggcgctggagctgttgcagcaggatgcccatctc
gaccgtatttttgtgccggtgggcggcggcgggctggccgccggcgtggccgtactgatt
aaacagctgatgccgcaggtcaaggtgatcggcgtggaggccgaggactccgcctgcctg
cgagcggcgctggatgccggtcagccggtggatctgccgcgggttggcctgttcgctgaa
ggggtggcggtcaaacgcatcggtgacgagacgttccgcctgtgccagcgctatttggac
gatgtgattacggtggatagcgacgctatctgcgccgccgtcaaggacctgtttgaggat
gtgcgggccgtggcggagccgtcgggcgcgctggcgctggccgggttgaaacagtatgtc
cagcgacacgcgctgcgcggcgagcggctggcgcacgtgctgtccggcgccaatctgaac
tttcacggcctacgctatgtatcagagcgctgtgagctgggtgagcagcgcgaggcgctg
ctggcggtgaccatcccggagcgtaagggaagcttcctggcgttttgtcagctgctgggg
gggcgttcggtgaccgagtttaactaccgctacgccgatgccgacagcgcctgcattttt
gtcggcgtgcggctgaccaacgggcgtggcgagcgtgaggagatcatcgcctcgctgcgc
ggcggcggctatcaggtggtggatctctccgatgatgagatggccaagctgcacgtgcgc
tatatggtgggcggccggcccagtaagccgctgcaggagcgcctgtatagctttgagttt
cccgaggctcccggggcgctgctgaagttcctgcataccctgggcacccattggaacatc
tccctgtttcactatcgcagccacggcaccgactttggccgggtactggcggcgtttgag
cggccggacagcgatgccagcttcgaggcgcgtctcaaagagctgggctatgagtgccac
gatgagacggggaatccggcgtttcgcttctttttgcagggatag

KEGG   Edwardsiella piscicida C07-087: ETAC_04275Help
Entry
ETAC_04275        CDS       T02509                                 

Definition
(GenBank) Threonine dehydratase
  KO
K01754  threonine dehydratase [EC:4.3.1.19]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00260  Glycine, serine and threonine metabolism
etc00290  Valine, leucine and isoleucine biosynthesis
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01130  Biosynthesis of antibiotics
etc01200  Carbon metabolism
etc01230  Biosynthesis of amino acids
Module
etc_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ETAC_04275
   00290 Valine, leucine and isoleucine biosynthesis
    ETAC_04275
Enzymes [BR:etc01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.1  Ammonia-lyases
    4.3.1.19  threonine ammonia-lyase
     ETAC_04275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AGH72986
Position
982177..983166
Genome map
AA seq 329 aa AA seqDB search
MHITYDLPVSIDDIQAAKKRLSGKIYKTGMPRSNYLSERCKGEIFLKFENMQRTGSFKIR
GAFNKLSSLTESERRKGVVACSAGNHAQGVSLSCAMLGIDGKVVMPTCAPKSKVAATCDY
SAEVVLYGNNFNDTISKVSEIVEMEGRIFIPPYDDPMVIAGQGTIGLEILEDLYDVDNVI
VPVGGGGLIAGIAIAIKSINPTIRIIGVQSENVHGMAASYYAGEIATHRTSGTLADGCDV
SRPGNLTFEIARELVDDMVLVSEEEIRASMVALIQRNKVITEGAGALASAALLSGKLDQY
IKGRKSVSIISGGNIDLSRVSQITGLVDA
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgcatattacatatgatcttcccgttagcattgatgatattcaagcagcaaaaaaaaga
ctctccggaaaaatatataaaacagggatgccgcgctctaattatcttagcgaacgctgt
aagggcgaaatatttttgaagtttgaaaatatgcagcgtaccggttcgtttaaaattcgc
ggtgcgttcaataagctgagctccctgacggagagcgaacgccgcaagggggtggtggcc
tgctccgccggtaaccatgcccagggagtttcactctcctgcgccatgctggggatcgac
ggtaaagtcgtcatgccgacctgcgcgcccaaatccaaggtcgcggccacctgcgactat
tcggcggaggtcgtgctgtatggcaataacttcaacgacaccattagcaaggtgagtgag
atcgtcgagatggaagggcggatatttattccaccttacgatgatccgatggtgattgct
ggtcagggaaccatcggtctggagattttagaagatctctatgatgtcgataatgttatt
gtaccggtcggcggcggtgggctgattgccggtatcgcgattgcgattaaatcgattaac
ccgaccatccgtatcatcggcgtgcagtcggaaaacgtacacggtatggcggcatcctat
tacgccggggagatcgcgacccatcgtacgagcggtacgctggccgacggctgcgatgtt
tcgcgtccaggaaacctgacctttgagattgcccgcgagctggttgacgacatggttctg
gtcagcgaagaggagatccgggccagcatggtggcgctgatccagcgtaataaggtgatt
accgaaggggccggtgccttagcctctgccgcactgctgagtggaaagctcgatcagtat
attaaagggcgtaaaagcgtcagcatcatctccggtgggaatattgacctctcccgtgtt
tcgcaaattaccggtctggtagacgcctga

KEGG   Edwardsiella piscicida C07-087: ETAC_08440Help
Entry
ETAC_08440        CDS       T02509                                 

Definition
(GenBank) L-serine dehydratase 1
  KO
K01752  L-serine dehydratase [EC:4.3.1.17]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00260  Glycine, serine and threonine metabolism
etc00270  Cysteine and methionine metabolism
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01130  Biosynthesis of antibiotics
etc01200  Carbon metabolism
etc01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ETAC_08440
   00270 Cysteine and methionine metabolism
    ETAC_08440
Enzymes [BR:etc01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.1  Ammonia-lyases
    4.3.1.17  L-serine ammonia-lyase
     ETAC_08440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SDH_alpha SDH_beta
Motif
Other DBs
NCBI-ProteinID: AGH73809
Position
1919940..1921307
Genome map
AA seq 455 aa AA seqDB search
MISVFDMFKIGIGPSSSHTVGPMKAGKQFVDDLAAQGLLPSVTRVAVDVYGSLSLTGKGH
HTDIAIIMGLAGNLPDSVDIDAIPEFIRTVESSERLPLGREGHPVIFPRDGGMVFRSDNL
PLHENGMTIRAYGAGDAPLYSKTYYSIGGGFIVDEEHFGQDSGDDVKVPYPFHSAQALLD
YCEETGLSISGLVMKNELALHGKEEIYAYFTAIWDTMQACIERGLNTEGILPGPLRVPRR
AAALRRMLVTSDKYSRDPMNVIDWVNMFALAVNEENAAGGRVVTAPTNGACGIVPAVLAY
YDHFIEPVTPDVFVRYFLASGAIGALYKMNASISGAEVGCQGEVGVACSMAAAGLAELLG
GSPVQVCIAAEIGMEHNLGLTCDPVAGQVQVPCIERNAIASVKAINAARMALQRTSAPRV
SLDKVIETMYETGKDINAKYRETSRGGLAIKVQCG
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
gtgattagcgttttcgacatgttcaagatcggcattggcccctccagctcccatacggtc
ggcccgatgaaagccgggaaacagtttgtcgatgatctggcggcgcagggtctgttgccg
tcggtcacgcgcgttgccgttgacgtttacggctcgctctcactgaccggtaaaggccat
cacaccgatatcgccatcattatggggctggcgggaaacctgccggacagcgtcgacatc
gacgccattcccgagtttatccgtaccgtggagagcagcgaacggctgcccctgggccgc
gaaggccacccggtcatcttccctcgcgacggcggtatggtcttccgcagcgataacctg
ccgctgcatgaaaacgggatgaccatccgcgcctacggcgccggcgacgccccgctgtac
agcaaaacctactactccatcggcggcggctttatcgttgatgaggagcactttggccag
gacagcggcgacgacgtcaaggttccctatccgttccactccgcgcaggcgctgctggac
tattgtgaagagaccgggctctccatcagcgggctggtaatgaaaaatgagctggcgctg
cacggcaaagaggagatttacgcctacttcaccgccatctgggacaccatgcaggcctgc
attgagcgcggactgaacaccgaaggcattctgccggggccgctgcgggtgccgcgccgc
gccgccgcgctgcgtcggatgctggtcaccagcgacaaatactcacgcgatccgatgaac
gtgatcgactgggtcaacatgtttgccctggcggtcaatgaagaaaacgccgccggcgga
cgcgtcgtcaccgcgccgaccaacggcgcctgcggcatcgtaccggccgtgctggcctac
tacgaccactttattgaacccgtgaccccggatgtcttcgtgcgctacttcttggccagc
ggcgctatcggcgccctgtataagatgaacgcctcgatctccggcgccgaagtcggctgt
cagggcgaggtgggcgtcgcctgctccatggccgccgccgggctggctgagctgctgggc
ggcagcccggtgcaggtgtgcatcgccgcagagattggcatggagcataacctggggctg
acctgcgatccggtcgccggtcaggtacaggtaccgtgcatcgagcgtaacgccatcgcc
tcggtgaaagcgatcaacgcggcccgcatggcgctgcagcgcacctccgcgccgcgcgtc
tccctggacaaggtgattgagaccatgtacgagaccggcaaagacatcaacgccaagtac
cgagaaacctcgcgcggcggcctggctatcaaggttcagtgcggctga

KEGG   Edwardsiella piscicida C07-087: ETAC_10710Help
Entry
ETAC_10710        CDS       T02509                                 

Definition
(GenBank) L-serine dehydratase
  KO
K01752  L-serine dehydratase [EC:4.3.1.17]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00260  Glycine, serine and threonine metabolism
etc00270  Cysteine and methionine metabolism
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01130  Biosynthesis of antibiotics
etc01200  Carbon metabolism
etc01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ETAC_10710
   00270 Cysteine and methionine metabolism
    ETAC_10710
Enzymes [BR:etc01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.1  Ammonia-lyases
    4.3.1.17  L-serine ammonia-lyase
     ETAC_10710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SDH_alpha SDH_beta MmgE_PrpD CT_C_D
Motif
Other DBs
NCBI-ProteinID: AGH74263
Position
2429918..2431285
Genome map
AA seq 455 aa AA seqDB search
MISVFDIYKIGIGPSSSHTVGPMKAGKQFCDDLIEKGLLNDVTRVVVDVYGSLSLTGKGH
HTDLAIIMGLAGNLPDSVDIDSIPGFIKDVETRDRLLMANGQHEVAFPLETSMNFHEDNL
SLHENGMRITALAGDKVLYSKTYYSIGGGFIVDEEHFGQQSSQQAAVPYPYNSAADLQRH
CKESGLSLSGLVMQNELALHSKDEIAAHFSRVWDVMRTGIERGINTEGVLPGPLRVPRRA
SALRRMLVTNDKTSVDPMAVVDWINMFAFAVNEENAAGGRVVTAPTNGACGIIPAVLAYY
DKFIREVNANSYTRYFLASGVIGTLYKMNASISGAEVGCQGEVGVACSMAAAGLAELLGG
SPAQVCMAAEIAMEHNLGLTCDPVAGQVQVPCIERNAIAAVKAVNAARMALRRTSDPRVC
LDKVIETMYETGKDMNAKYRETSRGGLALKVLSCG
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgattagcgtttttgacatttacaagatcggcattggcccatccagctcccataccgta
gggccgatgaaggccggtaaacaattttgcgatgaccttatcgaaaaaggtctgctaaac
gacgtcacccgcgtcgttgttgacgtttatggctccctatccctaaccggcaagggccac
cacaccgatctggccatcatcatgggactggccggtaacctgccggacagcgtcgatatc
gacagcatccccggcttcatcaaagacgttgagacccgcgatcgtctgctgatggccaac
ggacagcatgaggtggcgttcccgctggaaaccagcatgaacttccacgaagacaacctg
tctctgcatgaaaacggtatgcgcatcaccgcgctggccggagataaggtgctctacagc
aagacctactactctatcggcggcggctttatcgttgacgaagagcactttggtcagcag
agcagtcagcaggctgccgtcccgtacccctataacagcgccgccgatctgcagcgtcac
tgtaaagagtccgggctctccctgtccggcctggtgatgcaaaatgaactggccctgcac
agcaaggacgagatcgcggcccacttctctcgggtttgggacgtgatgcgcaccggcatc
gagcgcggcatcaacaccgagggcgttctgcctgggccgctgcgcgtaccgcgtcgcgcc
tctgccctgcgccgtatgctggtcaccaatgacaagaccagcgtcgatccgatggccgtt
gtcgactggatcaacatgttcgccttcgcggtgaacgaagagaacgccgccggcggccgc
gtcgttaccgcgccgaccaacggcgcctgcgggatcatccccgccgttctggcctactac
gataagtttattcgtgaggtgaacgccaactcgtatacccgctatttcctggcctccggc
gtcatcggcacgctgtataagatgaacgcctccatctccggcgccgaagtgggctgtcag
ggtgaggtcggcgtcgcctgttctatggccgcggccggtctggctgaactgctgggcggc
agtccggctcaggtctgcatggcagccgaaatcgccatggagcacaacctggggctcacc
tgcgatccggtcgccggtcaggttcaggtcccgtgcatcgagcgtaacgccatcgccgcc
gtcaaagcggtgaacgcggcgcgtatggcgctgcgccgcaccagcgatccgcgcgtctgc
ctggataaggttatcgaaaccatgtacgaaaccggcaaggacatgaacgccaagtaccgt
gaaacctctcgcggcggtctggcgctgaaagtgctctcctgcggttaa

DBGET integrated database retrieval system