KEGG   Edwardsiella piscicida C07-087: ETAC_00330Help
Entry
ETAC_00330        CDS       T02509                                 

Definition
(GenBank) ketol-acid reductoisomerase
  KO
K00053  ketol-acid reductoisomerase [EC:1.1.1.86]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00290  Valine, leucine and isoleucine biosynthesis
etc00770  Pantothenate and CoA biosynthesis
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01130  Biosynthesis of antibiotics
etc01210  2-Oxocarboxylic acid metabolism
etc01230  Biosynthesis of amino acids
Module
etc_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
etc_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    ETAC_00330
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    ETAC_00330
Enzymes [BR:etc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.86  ketol-acid reductoisomerase (NADP+)
     ETAC_00330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IlvN IlvC 2-Hacid_dh_C ApbA NAD_binding_7 Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: AGH72199
Position
70231..71709
Genome map
AA seq 492 aa AA seqDB search
MTNYFNTLNLRQQLAQLGKCRFMARAEFADGVNALRGKKVVIVGCGAQGLNQGLNMRDSG
LDVAYALRAEAIAERRDSYRRATEHGFSVGDYQTLIPQADLVINLTPDKQHAAVVSAVQP
LMKQGAALGYSHGFNIVEVGQQIRPDITVVMVAPKCPGTEVREEYKRGFGVPTLIAVHPE
NDPRGEGMAIAKAWASATGGDRAGVLASSFVAEVKSDLMGEQTILCGMLQTGSLLCYERL
VAEGADPAWAGKLIQFGWETITEALKQGGITLMMDRLSNPAKLRAYALAEQLKTLMAPLF
AKHMDDILSGAFSQGMMADWAADDDHLLTWRAETGESAFEKAPPFEGKIDEQTYFDRGVL
LVAMVKAGVELAFETMVASGIVAESAYYESLHELPLIANTIARRRLYEMNVVISDTAEYG
NYLFANAAVPLLRQAFMATLQPGDLGQSLPAGAVDNAALREVNQAIRQHPIETVGERLRG
YMTDMKRVAVAG
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgaccaactattttaatacgctgaatctgcgtcagcagctggcgcagctgggtaagtgc
cgttttatggcgcgggcggagtttgccgatggggtcaatgccctgcgcggtaagaaggtg
gtgatcgtcggctgcggcgcccaggggctgaaccaggggctgaacatgcgcgactcgggg
ctggacgtcgcctatgccctgcgggcagaggcgatcgccgaacggcgcgactcatatcgt
cgcgccaccgagcacggtttcagcgtcggggattatcaaaccctgatcccccaggccgat
ctggttatcaacctgacgccggacaaacagcatgccgccgtggtcagcgcggtgcagccg
ctgatgaagcagggggcggcgctggggtattcgcacggcttcaatatcgttgaggtgggg
cagcagatccgcccggacatcaccgtggtgatggttgcccccaagtgccccggcaccgaa
gtgcgcgaggagtataagcgcggctttggtgtaccgaccctgatcgcggtgcacccggaa
aacgatccgcgcggagaggggatggcgattgccaaggcgtgggcgtcggcgaccggcggc
gatcgcgccggggtgttggcgtcatcgtttgtggcggaggtaaagtctgacctgatgggc
gagcagaccattctgtgtgggatgctgcagaccggctcgctgctgtgctatgagcgtttg
gtcgccgagggggccgatccggcctgggccggcaagctgatccagtttggctgggagacc
atcaccgaggccctgaagcagggcgggatcaccctgatgatggatcgcctctccaatccc
gccaagctgcgcgcctatgcgttagccgagcagctcaagacgctgatggcgccgctgttt
gccaagcatatggatgacattctctccggggccttctcgcaggggatgatggcggactgg
gccgcggacgatgatcacctgctgacctggcgcgcggagaccggcgaaagcgcctttgaa
aaggcgccgccgtttgagggcaagatcgatgagcagacctatttcgatcgcggtgtgctg
ctggtggcgatggtgaaggccggggtcgagctggcctttgaaaccatggtcgcctccggc
atcgtcgccgagtccgcctactatgagtcgctgcatgagctgccgctgatcgccaatacc
atcgcccgtcggcgactgtatgagatgaacgtggttatctcggataccgccgaatatggc
aactacctgtttgctaacgcggcggtaccgctgctgcgccaagcgtttatggcgacgctg
cagccgggggatctggggcagtcgctgccggcgggggcggtggataacgccgcgctgcgg
gaggtcaatcaggccatccgtcagcatcccattgagacggtcggtgagcgcctgcgcggc
tatatgaccgatatgaagcgcgtggccgtcgccggttag

DBGET integrated database retrieval system