KEGG   Edwardsiella piscicida C07-087: ETAC_00430Help
Entry
ETAC_00430        CDS       T02509                                 

Definition
(GenBank) uroporphyrinogen III C-methyltransferase
  KO
K02496  uroporphyrin-III C-methyltransferase [EC:2.1.1.107]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00860  Porphyrin and chlorophyll metabolism
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01120  Microbial metabolism in diverse environments
Module
etc_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    ETAC_00430
Enzymes [BR:etc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     ETAC_00430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HemX UPF0242 RskA DUF4633
Motif
Other DBs
NCBI-ProteinID: AGH72219
Position
complement(94805..95953)
Genome map
AA seq 382 aa AA seqDB search
MTEPTTPPDKAAAAETATEQAQPLERAHKQDKQIVKKSAAGGPALGAIAIVLVIALGAGL
YYHGHQQAQRQQASEQSLQEQLSALHTAQAQEKLRMEALLNKQAKALDVATQLQASQSQQ
LKELEQKVAAISGNDANTWKLAQADFMVKLAERKLWSDQDVTTAIALLKSADATLAGLDD
PSLLGVRRALTEDISTLSALNQIDFDGIILQLNQLANQVDDLRLADNDSDEAPMDQDDGE
LSASLSQWRQNLAKSWHSFISEFITIRRRDSSAEPLLAPSQDVYLRENIRSRLLIAAQAV
PRHQNQIYQQSLESVSAWVRAYFDVNDPSTKAFLNQIDALSQQSVSMILPDALKSQPLLD
KLLHARSNALTAAPAAPATQGE
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgacggaacccactaccccgccagacaaggcggccgccgccgaaacggctaccgagcag
gcgcagccgctggagcgcgctcacaaacaggataagcagatcgtgaaaaaatccgccgcc
ggtggcccggcgctcggcgccattgccatcgtactggtgatcgccctcggtgccggcctt
tattaccacgggcatcaacaggcacagaggcagcaagccagcgaacaaagcctgcaggag
cagctcagcgcgctgcataccgcgcaggcacaggaaaaactgcggatggaggcgctgctg
aataaacaggcgaaggcgctggatgtcgcgacgcagctgcaggccagccagtcacagcag
ctcaaggagctggagcaaaaggtcgcggcgatctccggcaatgacgccaacacctggaag
ctggcgcaggccgattttatggtgaagctggccgagcgtaagctgtggagcgatcaggac
gtcaccaccgccatcgccctgctgaagagtgccgacgccaccctggccggcctggatgac
cccagtctgctgggcgtacgccgcgcgctgacggaggatatctccactctctccgcgctc
aaccagatcgactttgacggcatcatcctccagctgaatcagctggccaatcaggtggac
gatctgcggctggcggataacgacagcgacgaagcgccgatggatcaggacgacggtgag
ctgagcgcctcgctgagtcaatggcgacagaacctggccaaaagctggcacagcttcatc
tctgaatttatcaccatccgtcgtcgcgatagcagcgctgagcccctgctggcgcccagc
caggacgtatacctgcgtgagaatatccgctctcgcctgctgatcgccgctcaggcggta
ccgcgccaccagaatcaaatctaccagcagtcgctggaaagcgtctcagcctgggttcgc
gcctattttgacgtcaacgatccgagcaccaaggcgtttttaaaccagattgacgccctt
agccagcagtccgtcagcatgatattgcccgatgccctgaagagtcagccgctgctggat
aaactgctgcacgcccggagcaacgcgctgaccgccgcgccggccgcgcccgcgacgcag
ggggaatga

KEGG   Edwardsiella piscicida C07-087: ETAC_15520Help
Entry
ETAC_15520        CDS       T02509                                 

Gene name
cysG
Definition
(GenBank) siroheme synthase
  KO
K02302  uroporphyrin-III C-methyltransferase / precorrin-2 dehydrogenase / sirohydrochlorin ferrochelatase [EC:2.1.1.107 1.3.1.76 4.99.1.4]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00860  Porphyrin and chlorophyll metabolism
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01120  Microbial metabolism in diverse environments
Module
etc_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    ETAC_15520 (cysG)
Enzymes [BR:etc01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.76  precorrin-2 dehydrogenase
     ETAC_15520 (cysG)
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     ETAC_15520 (cysG)
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.4  sirohydrochlorin ferrochelatase
     ETAC_15520 (cysG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TP_methylase NAD_binding_7 CysG_dimeriser Sirohm_synth_M Radical_SAM
Motif
Other DBs
NCBI-ProteinID: AGH75225
Position
3504218..3505603
Genome map
AA seq 461 aa AA seqDB search
MDYFPIFCQLRTKPCLLVGGGEVAERKARLLMEAGAILTVNAGRFTPQFEQWQRDGQLTL
IAGDFDPALLTGKWLAIAATDDSRVNQQVLAQAEARCLFCNVVDAAQQTGFIMPSIVDRS
PLMVAVSSGGSAPVLARILREKLEALLPQHLGQLAHLAGHLRQRVKAHFPTLSLRRRFWE
RLFAQDRLAQSLANGDTAQTQQQVDALFSAAPADRGEVTLVGAGPGDAGLLTLKGLQQIQ
RADVIIYDRLVSDEVMSLVRRDATRIFVGKRAGHHCVPQEEINQTLLDHAREGKRVVRLK
GGDPFIFGRGGEELEALAAAGIAFSVVPGITAASGCSAYSGIPLTHRDHAQSVRLVTGHT
RQDGQLDWSCLAAAGQTLVFYMGLSQAATIQQRLLQHGMLPDTPVALVENGTTVRQRVVS
GTLTQLETLATRVTSPSLIIVGDVVTLRPRLNWFRSEETSA
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atggattactttccgatattttgtcagctgcgtactaagccctgcctgctggtcggcggc
ggcgaagtggccgagcgtaaggcccgcctgttgatggaggcgggcgcgattttgacggtg
aacgccgggcgcttcacgcctcagttcgagcagtggcagcgggatggtcagctgacgctg
atcgccggcgacttcgaccccgcgctgctcacgggcaagtggctggctatcgccgccacc
gacgacagccgggtcaatcagcaggtgctggcacaggccgaggcgcgctgcctcttttgt
aacgtggtcgacgccgcacaacagacaggctttatcatgccatcgatcgtcgatcgctca
ccgctgatggtcgccgtctcctccggcggcagcgcgccggtgctggccaggattctgcgc
gaaaagctggaggcgctgctaccgcagcatctcggccagctggcgcacctggctggccac
ctgcgccagcgcgtcaaggcacactttcccaccctgtcgctgcgccgtcgcttttgggaa
cggctgttcgcccaagatcgtctggcgcagtcgctggccaacggcgataccgcacagaca
cagcagcaggtggatgcgctgttcagcgcggcaccggcggatcgcggcgaggtgacgctg
gtcggcgccgggccgggggatgcagggctgttgaccctcaaagggctacagcagatccag
cgggcggatgtgatcatctacgatcgcctggtatccgatgaggtcatgtcgctggtgcgg
cgcgatgcgacgcgtatcttcgtcggcaaacgcgccggccatcactgcgttccccaggag
gagatcaatcagaccctgctggatcacgcgcgcgaaggcaaacgggtcgtgcgcctaaaa
ggcggcgatccctttatctttggccgggggggcgaagagcttgaggcgctggccgccgcg
gggatcgccttttcggtggtgcccggcattaccgccgcctccggctgctccgcctatagc
ggtattccgctgacccaccgcgaccatgcccaaagcgtccgcctggtcaccggccatacc
cgccaggatggccagctagactggtcctgcctggctgccgcaggacaaacgcttgtgttt
tacatggggctgagccaggcggcgaccattcagcagcgcctcttgcagcacggtatgctg
ccagatacccccgtcgccctggttgaaaacggcaccacggttcgccagcgggtcgtcagc
ggaacactgactcagctggaaacgttggcaacgcgcgtgaccagccccagcctgatcatc
gtcggcgacgtcgtcaccctgcggccacgcctcaactggtttcgcagcgaagagacgagc
gcgtaa

DBGET integrated database retrieval system