KEGG   Edwardsiella piscicida C07-087: ETAC_00435Help
Entry
ETAC_00435        CDS       T02509                                 

Definition
(GenBank) uroporphyrinogen-III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00860  Porphyrin and chlorophyll metabolism
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01120  Microbial metabolism in diverse environments
Module
etc_M00121  Heme biosynthesis, glutamate => heme
etc_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:etc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    ETAC_00435
Enzymes [BR:etc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     ETAC_00435
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-ProteinID: AGH72220
Position
complement(95972..96718)
Genome map
AA seq 248 aa AA seqDB search
MSILVTRPSPAGEQLVERLRALGMEAWHTPLIDVAPGRQLALLPEAVAALQRGDLLLAVS
RHAVLYAAEALRLAGRGWPTTPRYAAIGHSTAQSLGAACHQPVIFPPAPETSEALLALPA
IRQLRARRALILRGNGGRDLIADALRARGVSVTLCECYRRVAIAYPGDELCARWRQQKVS
TLVVTSGEMLQQLYDLVPEYDRQRWLLSCRLIVVSERLAQRARDLGWQEIRVAESANNDA
LLRTLQIN
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgagcattctggtgacccgcccctcccccgccggtgaacagctggtcgagcgcctgcga
gcgctggggatggaggcgtggcatacgccgctgatcgacgttgcccccggtcggcagctg
gcgctgctgccggaggccgtggccgcgctgcagcggggcgatctgctgctggccgtctct
cgccacgccgtcctctacgccgcagaggcgctgcgactggccggtcgcggctggcccacg
accccgcgctacgccgctatcgggcacagtaccgcacagtcgctaggggccgcctgtcac
caaccggtgatctttccgccagcgccggaaacctcggaggcgctgctggcgctgcccgcc
atacggcagctgcgggcccggcgggccctgatcctgcgcggtaacggcgggcgcgacctg
atcgccgatgccctgcgcgcgcgcggcgtttcggtcaccctatgcgaatgctatcgccgg
gtcgccatcgcctaccccggtgacgagctctgcgcgcgctggcggcaacagaaagtctcg
acactggtagtgaccagtggtgaaatgctgcaacagctctatgatttagttcctgaatac
gatcggcaacgttggctcctcagctgccggctgatcgtcgtcagcgaacgtctggcacag
cgcgcccgggatctgggatggcaggagatccgggtggcggaaagcgccaacaatgatgcg
ctattgcgtacgctacagatcaactga

DBGET integrated database retrieval system