KEGG   Edwardsiella piscicida C07-087: ETAC_00460Help
Entry
ETAC_00460        CDS       T02509                                 

Gene name
dapF
Definition
(GenBank) diaminopimelate epimerase
  KO
K01778  diaminopimelate epimerase [EC:5.1.1.7]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00300  Lysine biosynthesis
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01120  Microbial metabolism in diverse environments
etc01130  Biosynthesis of antibiotics
etc01230  Biosynthesis of amino acids
Module
etc_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    ETAC_00460 (dapF)
Enzymes [BR:etc01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.7  diaminopimelate epimerase
     ETAC_00460 (dapF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAP_epimerase PhzC-PhzF
Motif
Other DBs
NCBI-ProteinID: AGH72225
Position
101230..102054
Genome map
AA seq 274 aa AA seqDB search
MQFAKMHGLGNDFMVVDAVTQNVYFSPELIRRLADRHTGVGFDQLLVVEPPYDPDLDFHY
RIFNADGSEVAQCGNGARCFARFVRIKGLTNRRDIRVSTQNGRMTLHVGEDDRVTVNMGE
PQFEPGRIPFKAAKAEKTYILRVAQQTVLCGAVSMGNPHCVLQVEDVSRAQVELLGPVLE
SHERFPERVNVGFMQVVERDHIRLRVYERGAGETQACGSGACAAVAVGIQQGLLDEQVQV
DLPGGTLHIRWPGPGTPLLMTGPAAHVYDGFIHL
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgcagtttgccaagatgcacgggctgggtaatgattttatggtggtggatgccgtcacc
cagaacgtttacttttcaccggagttgatccgccgcctggccgacaggcataccggcgtc
ggcttcgatcagctgttggtggtggaaccgccctacgatcccgatctggactttcactat
cgcatctttaacgccgacggcagcgaggttgcgcagtgcggcaatggcgcgcgctgcttt
gcccgttttgttcggatcaaggggctgaccaaccggcgcgatatccgcgtcagcacccag
aatggccgcatgacgctgcacgtaggcgaggacgatcgggtgacggtcaatatgggagag
ccgcagtttgagccggggcgtatccctttcaaagccgccaaggcggagaaaacctatatt
ctacgcgtggcgcagcagacggtgctgtgcggcgcggtctcgatgggaaaccctcactgt
gtcctgcaggttgaggacgtcagccgggctcaggttgagctgctgggaccggtgctggag
agccatgagcgctttcctgagcgggtaaacgttggctttatgcaggtggtcgagcgtgac
catatccggctacgggtatatgagcgcggcgccggcgagacgcaggcctgcggcagcggc
gcctgtgcggcggtcgccgtggggatccagcaggggctgctggatgagcaggtgcaggtg
gatctgcccggcggtactctgcacatccgttggccggggccgggaacgccgctgttgatg
accggacctgccgcccacgtctatgatggattcatccatttgtaa

DBGET integrated database retrieval system