KEGG   Edwardsiella piscicida C07-087: ETAC_00525Help
Entry
ETAC_00525        CDS       T02509                                 

Gene name
gntK
Definition
(GenBank) gluconate kinase 1
  KO
K00851  gluconokinase [EC:2.7.1.12]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00030  Pentose phosphate pathway
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01120  Microbial metabolism in diverse environments
etc01130  Biosynthesis of antibiotics
etc01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    ETAC_00525 (gntK)
Enzymes [BR:etc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.12  gluconokinase
     ETAC_00525 (gntK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_33 AAA_18 APS_kinase AAA_16 Cytidylate_kin2 Cytidylate_kin Zeta_toxin AAA_17 AAA AAA_22 RsgA_GTPase CoaE AAA_29 DUF2075 CPT SMC_N ABC_tran AAA_5 AIG1 AAA_7 IPT
Motif
Other DBs
NCBI-ProteinID: AGH72238
Position
complement(116016..116546)
Genome map
AA seq 176 aa AA seqDB search
MSESQQQKHVFVLMGVSGSGKSAVANAVAQRLGAAFLDGDFLHPRANISKMADGHALNDD
DRTPWLQALNDAVFAMQRTNDVSLIVCSALKKRYRDMLRDGNTNLSFIYLQGDFALIESR
LLARKGHFFKPQMLVSQFAALEEPTTEERDVYAIDISQPLDSVVADTLNTIKSIIA
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaaagccaacagcaaaaacacgtctttgttctgatgggcgtttccggcagcggc
aagtccgccgtcgccaacgccgtcgcccaacggctgggcgccgcctttctggacggcgac
ttcctacacccgcgcgccaacatcagcaagatggccgacggccacgcgctgaacgatgac
gatcgcacgccgtggctccaggccctcaacgatgcggtcttcgccatgcagcgcaccaac
gacgtctcgctgatcgtctgctcggcgctgaaaaagcgttaccgcgacatgctgcgcgac
ggtaacaccaacctctcattcatctacctgcagggtgacttcgccctgatcgaaagccgc
ctgctggcgcgcaaaggacacttcttcaaaccgcagatgctggtttcccagtttgcggcc
ctggaagagccgacgaccgaagagcgcgacgtatacgccatcgacatcagccagccgctg
gacagcgtggtggccgataccctgaataccattaaatccatcattgcctag

DBGET integrated database retrieval system