KEGG   Edwardsiella piscicida C07-087: ETAC_00565Help
Entry
ETAC_00565        CDS       T02509                                 

Definition
(GenBank) 5-methyltetrahydropteroyltriglutamate--homocysteine S-methyltransferase
  KO
K00549  5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase [EC:2.1.1.14]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00270  Cysteine and methionine metabolism
etc00450  Selenocompound metabolism
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01230  Biosynthesis of amino acids
Module
etc_M00017  Methionine biosynthesis, apartate => homoserine => methionine
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    ETAC_00565
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    ETAC_00565
Enzymes [BR:etc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.14  5-methyltetrahydropteroyltriglutamate---homocysteine S-methyltransferase
     ETAC_00565
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Meth_synt_2 Meth_synt_1
Motif
Other DBs
NCBI-ProteinID: AGH72246
Position
125758..128034
Genome map
AA seq 758 aa AA seqDB search
MQVISHTLGFPRIGLQRELKKALEAYWSGSAPQSALLACGAELRARHWRQQHQAGIDLLP
VGDFAWYDHVLATSLMLGNVPARHRRADGVIDLDTLFGIARGRAPGGKPAAAAEMTKWFN
TNYHYIVPEFTRGQRFSFGWRQLLEEVDEALALGYRVKPVLLGPLTYLWLGKVKGAPFDR
LSLLEEVLAVYRQVLAALAERGVEWVQVDEPALVLTLPPAWRDAYQHAYQALRGPVKLLL
TTYFGDIGHHLPTICALPVQGLHVDLVQGAGDALALHRQLPADWVLSLGAIGGRNVWRAD
LADWQTRLQPLVGQRPVWLGSSCSLLHTPIDLSAETQLDEEVKSWFAFALQKCSELALLT
QALNDPASRREALLSYSAPLYLRRRSERVHNPAVTERLAALSDADTQRTSAYPQRARRQR
QRFALPLWPTTTIGSFPQTSAIRTLRLDFRRGQMTPQHYHRGIAEHIRQAIREQERLGLD
VLVHGEAERNDMVEYFGEQLAGFVFTCNGWVQSYGSRCVKPPVIVGDISRPAPLTVEWTT
FAQAQTSRPVKGMLTGPITMLCWSFAREDVPREVIARQLALALRDEVDDLQRAGIGIIQI
DEPALREGLPLRQDEWQAYLAWAVAAFRLTAAVAYDDTQIHTHMCYCEFNDIMAAIAALD
ADVITIETARSDMELLEAFSRFDYPNEVGPGVYDIHSPNVPTQAAMVSLLRRAAQHIPAE
RLWVNPDCGLKTRGWEETRRALSNMVAAARLLRAQTQA
NT seq 2277 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtaatcagtcataccctggggtttccacgcatagggctgcagcgtgagttgaaa
aaggcactggaggcctattggtcgggcagtgcgccccagagcgcgctactggcctgcggt
gccgagctgcgcgcccgccattggcggcagcagcatcaggcgggaatcgatctgctgccg
gtgggcgattttgcctggtatgaccatgtgttggcgaccagtctgatgctggggaatgtc
ccagcccgccaccggcgcgccgatggcgttatcgatctggatacgctgtttgggattgcg
cgtggccgggcgcccggaggaaagcccgcggcggcggcggagatgacaaaatggtttaac
accaactatcactatatcgtgcctgagtttacccgggggcagcgcttttcctttggctgg
cgccagctgctagaggaggtggatgaggcgctggcgctgggataccgggtaaaaccggtg
ctgctggggccgctgacctacctgtggctcggcaaggtaaaaggggcacctttcgatcgt
ctcagcctgctggaggaggtactggcggtataccgtcaggtgctggccgcgctggccgaa
cgcggggttgaatgggtgcaggtggatgagccggcgctggtgctgacgctgccgccggcg
tggcgcgatgcctatcagcatgcgtatcaggcgctgcgggggccggtgaagctgctgctg
accacctactttggcgatatcggccaccacctgccaacgatctgcgctctgccggtgcag
gggctacacgtcgatctggttcagggcgcgggcgatgcgctggcgctccaccgtcagctg
cccgccgactgggtgctatcgctgggcgcgatcggcggccgtaacgtctggcgcgccgat
ttggccgactggcagacgcgtctgcagccgctggtcggtcagcggcccgtctggctgggc
agttcctgctccctgctgcatacgcctatcgatctgagcgccgaaacccagctggatgag
gaggtgaaaagctggtttgcctttgccctgcagaagtgcagtgagctggcgctgctgacc
caggccctgaacgatccggcgtcgcggcgggaggcgctgctgagctacagtgcgccgcta
tacctgcgacgtcgctcggaacgggttcataacccggcggtgaccgagcgcctggccgca
ctgagcgacgcggatacgcagcgtaccagcgcatacccccagcgcgctcggcgtcagcgc
cagcgttttgctctgccgctctggccgacgacgaccatcggttcattcccgcagacgtcg
gctatccgcaccctgcgcctcgactttcgccgcggtcagatgaccccgcagcactaccat
cgggggatcgctgaacatatccgtcaggcgattcgcgagcaggagcgactggggctggac
gtactggtgcacggcgaggccgaacgtaatgatatggtggagtatttcggtgagcagctg
gcggggtttgtgtttacctgtaacggttgggtacagagctatggctcacgctgcgtgaag
ccgccggtgatcgttggggatatcagtcggcccgcgccgctgaccgtcgaatggaccacc
tttgctcaggctcagacctcccggccggtgaagggcatgctgaccggtccgataacgatg
ctgtgctggtcgtttgctcgtgaagatgtgccgcgagaggtgatcgctcgtcagctggcg
ctggcgctgcgcgacgaggtagacgacctgcagcgcgcggggatcggcatcattcaaatc
gacgagcccgcgctgcgcgagggcctgccgctgcgtcaggatgagtggcaggcgtacctg
gcgtgggccgtggcggcgttccgcctaacggcggcggtggcgtacgatgatacccagatc
catacccatatgtgctactgcgagttcaatgacatcatggcggcgattgcggcgctggat
gccgacgtgatcactattgagacggcgcgatcggatatggagctgctggaggccttttct
cgcttcgactatcccaatgaggtcggccccggggtgtacgatatccactcaccgaacgtg
ccgacgcaggcggcgatggtctcgctgctgcgtcgggcggcacagcatattcccgccgag
aggctgtgggtgaatccggactgtggtttaaagacgcgcggctgggaggagacccgtcgt
gcgctgagtaacatggtggcggcggcgcgtttgctgcgcgcgcagacgcaggcgtaa

KEGG   Edwardsiella piscicida C07-087: ETAC_00845Help
Entry
ETAC_00845        CDS       T02509                                 

Gene name
metH
Definition
(GenBank) B12-dependent methionine synthase
  KO
K00548  5-methyltetrahydrofolate--homocysteine methyltransferase [EC:2.1.1.13]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00270  Cysteine and methionine metabolism
etc00450  Selenocompound metabolism
etc00670  One carbon pool by folate
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01230  Biosynthesis of amino acids
Module
etc_M00017  Methionine biosynthesis, apartate => homoserine => methionine
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    ETAC_00845 (metH)
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    ETAC_00845 (metH)
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    ETAC_00845 (metH)
Enzymes [BR:etc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.13  methionine synthase
     ETAC_00845 (metH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Met_synt_B12 S-methyl_trans Pterin_bind B12-binding_2 B12-binding
Motif
Other DBs
NCBI-ProteinID: AGH72302
Position
203469..207152
Genome map
AA seq 1227 aa AA seqDB search
MNTTLERLRRRLEKRILVLDGGMGTMIQRYGLSEQDFRAERFADWPCDLKGNNDLLALTR
PDIISAIHYAYLEAGADILETNTFNATRIAMADYRMEALAPEINYRAACLARACADEWTA
RTPHQPRFVAGVLGPTNRTASISPEVNDPACRNITFDQLVAAYRESARALIEGGVDLLMI
ETVFDTLNAKAAVYALECEFAALGVTLPVMISGTITDASGRTLSGQTTEAFYNALRHARP
LSFGLNCALGPEDLRQYVAELSRVAECHVSAHPNAGLPNAFGEYDLSPQAMAQQIAEWAR
AGYLNIVGGCCGTTPEHIAAISRAVQGIAPRALPTLPVACRLSGLEPLTIDETSLFVNVG
ERTNVTGSAKFKRLIKENKYDEALDVARQQVASGAQIIDINMDEGMLDAEAAMVRFLNLI
AGEPDIARVPLMIDSSRWSVIEAGLKCIQGKGIVNSLSLKEGEANFLEHARQVRRFGAAL
VVMAFDEQGQADTRERKVAICRRAYQLLTERIGFPPEDIIFDPNIFAVATGIEEHSNYAV
DFIASCAEIKAQLPHALISGGVSNVSFSFRGNEAVREAIHAVFLYHAIRHGMDMGIVNAG
QLAIYDDLPDDLRTAAEAVILNQSPDATDRLLALAERYRDTQGSAQAEAQQAEWRSWPVA
QRLEYALVKGIGEFIAQDTEAARLEADRPIAVIEGPLMAGMNRVGDLFGDGKMFLPQVVK
SARVMKQAVAYLSPFIEASKQRGSSAGKVLLATVKGDVHDIGKNIVGVVLQCNNYEIIDL
GVMVPAERILRVAREERVDIIGLSGLITPSLDEMVNVASEMERQGFTLPLLIGGATTSKA
HTAVKIAPAYGGPTVYVQNASRTVGVVAALLSEAQRGPFIERTRREYEAARAQHGRQTPR
TPPVTLAQARANGVVTDWSACPPPVPQRLGVQTVQPGIARLRDYIDWTPFFLTWSLAGKY
PRILQDEVVGEEARRLLADANGLLDRLEASGSLTPRGVFGLFAANRRGDDVLIYRDESRR
EVLAVSHHLRQQSDKRAGPNYCLADFVAAADEGIADYIGAFAVTGGLEEEALAQAFDAQH
DDYHKIMVKALADRLAEAFAEYLHQQVRKVHWGYAADEALDNEQLIRENYRGIRPAPGYP
ACPEHSEKATLWRLLDVERHTGMRLTESYAMWPGASVSGWYFSHPHSKYFAVARVQRDQV
ADYAARKGMTLAEAERWLAPNLGYEVA
NT seq 3684 nt NT seq  +upstreamnt  +downstreamnt
gtgaatacgacgcttgaacggttgcgccgccggctggagaaacggattttggtgttggat
ggcggcatgggaaccatgatccagcgttacgggctgagcgaacaggatttccgcgccgaa
cgctttgccgattggccctgcgatctgaagggaaacaacgatctgctggcgctgacccgc
cccgatatcatcagcgcgattcattatgcctacctggaggcgggcgccgacattctggaa
accaacacctttaacgcaacgcgcatcgccatggcggactaccgcatggaggcgctggcg
ccggagataaattatcgggccgcctgccttgcgcgggcctgtgccgacgagtggacggcg
cgcacgccgcaccagccgcgcttcgtggcgggcgtgctggggccgaccaaccgtacggcg
tcgatctcgccggaggtcaacgatcccgcctgtcgcaatattactttcgatcagctggtg
gcggcctatcgcgagtcggcgcgggcgctgattgagggcggcgtcgatctgctgatgatc
gaaaccgtctttgataccctgaatgccaaggcggcggtttatgcgctggagtgcgagttt
gccgcgctgggcgtcacgctgccggtgatgatctccggcaccattaccgatgcctccggg
cgtaccctgtcggggcagacgaccgaggcgttttataacgccctgcgccacgcccgtccg
ctctctttcggtctgaactgcgctctgggcccggaggatctgcgccagtacgtggcggag
ctgtcccgggtcgccgagtgccacgtcagcgcccaccccaacgccgggctgcccaatgcc
tttggcgagtatgatctctcgccgcaggcgatggcgcagcagattgccgaatgggcccgc
gcgggctacctgaatatcgtcggcggctgctgcggtaccacgccggagcacattgccgcc
atcagccgggcggtgcagggcatcgcaccgcgcgcccttcccacgctgccggtggcctgc
cgtctgtccggtctggagccgctgacgatcgatgaaacgagtctgttcgtcaacgtgggc
gaacgcaccaacgtgaccggctctgctaaatttaagcgactgattaaagagaataaatat
gatgaggcgctggacgtggcgcgtcagcaggtggcgagcggcgcgcagatcatcgatatc
aatatggatgagggcatgctggatgccgaggcggcgatggtccgcttcctcaacctgatt
gccggcgagccggatatcgcccgggtgcccctgatgatcgactcctcccgctggtcggtg
atcgaggcggggctgaagtgcatccaggggaaaggcatcgtcaactcgctctctcttaaa
gagggagaggcgaactttctggagcacgcccgtcaggttcgccgctttggcgccgcgctg
gtggtgatggccttcgatgagcaggggcaggcggatacccgagagcgtaaggtggccatc
tgccgtcgcgcctatcagctgctgaccgagcgcatcggtttcccgcctgaagacatcatc
tttgaccccaatatttttgccgtggccaccggcattgaggagcacagtaactatgccgtc
gattttatcgcatcctgcgcggagattaaggcgcaattaccccacgccctgatctccggc
ggggtatcgaacgtctctttttccttccgcggtaacgaggcggtgcgagaggcgatccac
gcggtctttctgtatcacgcgattcgccacggcatggacatggggatcgttaacgccgga
cagctggctatctatgacgacctgccggacgatctgcgtacggcggccgaggcggtgatc
ctgaaccagagccccgacgccaccgatcgcctactggcgctggcggagcgctaccgcgac
acgcagggcagcgcgcaggcggaggcgcagcaggccgagtggcgcagctggccggtggcc
cagcgcctggagtatgccttggtcaagggcatcggcgagttcattgcgcaggataccgag
gcggcgcgtctggaggccgacaggccgattgcggtgatcgaagggccgctgatggcgggg
atgaaccgggtcggcgatctgtttggcgacggtaagatgtttctgccgcaggtggtgaag
tcggcgcgcgtgatgaagcaggcggtggcctatctgtcgccgtttatcgaggccagcaag
cagcgcggcagcagcgccggtaaggtgctgctggcgacggtgaagggcgacgtgcacgat
atcggcaagaatatcgtcggcgtagtgctgcagtgcaataactatgaaattatcgatctg
ggggtgatggtgcccgccgagcgaatcctgcgggtggcgcgcgaggagcgggtcgatatc
atcgggctgtcggggctgatcaccccctcgctggatgaaatggtcaacgtggccagcgaa
atggagcggcaggggttcacgctgccgctgctgatcggcggggcgacgacctccaaggcg
catacggcggtgaagattgcgcccgcctacggcgggccgacggtctatgtgcagaacgcg
tcgcgcaccgtcggcgtggtggccgccctcctgtcggaggcgcagcggggtccgtttatc
gaacggacgcgccgggagtatgaggcggctcgtgcccagcatggtcgccagacgccgcgc
acgccgccggtgacgctggcgcaggcgcgcgccaatggcgtcgtcaccgactggtcagcc
tgtccgccgccggtgccgcagcgcttaggggtacagacggtgcagccggggattgcgcgt
ctgcgcgactatatcgactggacgccgtttttcctcacctggtcattggccgggaaatac
ccgcggatcctgcaggatgaggtggtcggtgaggaggcgcggcgcctgctcgcggatgcc
aatgggttactggataggctggaggcgtccggtagtctgacgccgcgcggggtgttcggc
ctgttcgcggcgaaccggcggggggacgatgtgctgatttaccgcgacgagagccgccgc
gaggtgctggccgtcagccaccatctgcgccagcagagcgataaacgcgcggggcccaac
tactgcctggctgactttgtcgccgccgcggatgaggggatcgctgactatatcggcgcc
tttgccgtgaccggcgggctggaggaggaggcgctggcgcaggcctttgatgcgcagcac
gatgactaccataaaatcatggtgaaggcgttagcggatcgtctggcggaggcctttgcc
gaatacctgcatcagcaggtgcgcaaagtgcactggggctatgccgccgatgaggcgctg
gacaacgagcagctgatccgcgaaaactatcgcggcattcgcccggcgccgggctatccg
gcctgtccggagcacagtgaaaaggccacgctgtggcgtcttttagacgtcgaacgccac
accggcatgcggctgacggagtcttacgcgatgtggccgggcgcctcggtgtccggctgg
tacttcagccaccctcacagcaagtactttgccgtcgcgcgcgtgcagcgcgatcaggtg
gcggactatgccgcgcgtaaagggatgacgctggcggaggccgagcgttggctagcgccc
aatctgggctatgaggtggcgtaa

DBGET integrated database retrieval system