KEGG   Edwardsiella piscicida C07-087: ETAC_00750Help
Entry
ETAC_00750        CDS       T02509                                 

Definition
(GenBank) Uroporphyrinogen III decarboxylase
  KO
K01599  uroporphyrinogen decarboxylase [EC:4.1.1.37]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00860  Porphyrin and chlorophyll metabolism
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
Module
etc_M00121  Heme biosynthesis, plants and bacteria, glutamate => heme
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    ETAC_00750
Enzymes [BR:etc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.37  uroporphyrinogen decarboxylase
     ETAC_00750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: URO-D XPC-binding
Motif
Other DBs
NCBI-ProteinID: AGH72283
Position
175382..176446
Genome map
AA seq 354 aa AA seqDB search
MTELKNDRYLRALLRQPVDVTPVWMMRQAGRYLPEYNATRAQAGNFIALCKNAELACEVT
LQPLRRFPLDAAILFSDILTVPDAMGLGLYFEAGEGPRFTHPVTCHADIQRLPIPDPEQE
LGYVMDAVRTIRRDLRGDVPLIGFSGSPWTLATYMVEGGSSKAFTKIKKMMYSDPAALHL
LLDKLAQSVILYLNAQIRAGAQAVMIFDTWGGVLTGRDYREFSLRYMHQIVDGLQRESEG
RRVPVTLFTKGGGQWLEAMADTGCDALGLDWTCDIADARRRVGDRVALQGNMDPSLLYAP
PARIEQEVATILAGFGQGEGHVCNLGHGIHPDVPPEHAGVFVDAVHRLSVPYHR
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaactgaaaaacgatcgctacctgcgtgcgctgctgcgccagccggtcgatgtg
accccggtatggatgatgcgtcaggcggggcgctatctgccggagtacaacgccacccgc
gcgcaggccggtaactttatcgccctgtgtaaaaatgccgagctggcctgcgaggtgacg
ctgcagccgctgcgtcgtttcccgctggatgcggctattctgttttctgacatactgacc
gtgccagatgccatggggctgggcctctatttcgaggccggcgaggggccgcgttttacc
catccggtgacctgtcacgccgatatccaacggctcccgatccccgatcctgaacaggaa
ctgggctatgttatggacgcggtgcgtaccattcgtcgcgatctgcgcggcgacgtgccg
ctgatcggcttctccggcagcccctggacgctggcgacctatatggtagagggcggcagc
agcaaggcctttactaaaatcaagaagatgatgtactccgatccggcggcgctgcatctg
ctgctggataagctggcgcaaagcgtcattctgtatctgaatgcgcagatccgcgccggg
gcgcaggcggtcatgatctttgatacctggggaggcgtgctgaccgggcgcgactatcgc
gagttctctttgcgctacatgcaccagattgtcgatggcctacagcgcgagagcgaaggc
cgccgggtgccggtgaccctgtttaccaagggcggggggcagtggctggaggcgatggct
gatacgggctgcgatgctctgggactggactggacctgcgatattgcggacgcccgccgc
cgggttggcgatcgggtggcgctgcagggcaatatggatccttcgctgctgtatgcgccg
ccggcgcgcattgagcaagaggtcgcgacgatcctggccggctttggccagggcgaggga
cacgtgtgtaatctgggtcacggcattcatccggatgtccctcccgagcacgccggcgtg
tttgtcgatgcggtgcaccgactgtctgtaccttatcatcgctga

DBGET integrated database retrieval system