KEGG   Edwardsiella piscicida C07-087: ETAC_00775Help
Entry
ETAC_00775        CDS       T02509                                 

Definition
(GenBank) phosphoribosylamine--glycine ligase
  KO
K01945  phosphoribosylamine---glycine ligase [EC:6.3.4.13]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00230  Purine metabolism
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    ETAC_00775
Enzymes [BR:etc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.13  phosphoribosylamine---glycine ligase
     ETAC_00775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GARS_A GARS_N GARS_C ATP-grasp_3 CPSase_L_D2 ATP-grasp ATP-grasp_4 RimK tRNA_synt_1c_R1
Motif
Other DBs
NCBI-ProteinID: AGH72288
Position
complement(179058..180335)
Genome map
AA seq 425 aa AA seqDB search
MNILIIGSGGREHALAWKAAQSPLAERVFVAPGNAGTALEPALENIDIAATDIDALVAFA
LRHQIGLTIVGPEAPLVLGVVDAFRAAGLPIFGPSQSAARLEGSKAFSKDFLARQRIPTA
AYRNFTEVEPALAYVREQGAPIVIKADGLAAGKGVIVAMTREEAEAAVHDMLAGNAFGDA
GHRIVIEEFLEGEEASFIVMVDGEHVLPMATSQDHKRVGDGDSGPNTGGMGAYSPAPVVS
DAVHQRVMEQVIWPTVRGMAQEGAPYTGFLYAGLMISADGAPKVIEFNCRFGDPETQPIM
MRMQSDLVALCLAGANGTLDQQSSAWDPRPALGVVLAAGGYPGDYRQGDVIHGLTQGTAQ
AKVFHAGTRLNAQGEVETCGGRVLCATALGEDIAEAQRNAYRLADALSWEGGFCRRDIGY
RALQR
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgaatattttgattatcggcagcggcgggcgtgaacatgccctggcatggaaagcggcc
caatctccgctggccgaacgcgtatttgtcgcgccgggtaacgctggcactgcgctggaa
cccgcgctagagaatatcgatatcgccgcgaccgatatcgatgcgttagttgcatttgct
ttgcgccatcagatcgggctcacgatcgtcggtccagaggcgccgctggtgctcggggtg
gtcgatgcattccgcgcggcggggctgccgatctttggcccgagccaaagcgccgcccgc
ctcgaaggttccaaagcgttcagcaaagacttcctggcgcgtcagcgcatccctaccgcc
gcctaccgcaatttcaccgaggtcgagccggcgctggcctacgtgcgtgagcagggggca
ccgatcgtgatcaaggccgatggcctggccgcaggtaaaggggtgatcgtcgcaatgacg
cgggaggaggccgaagcggccgtccacgatatgctggccggtaacgcctttggcgacgcc
gggcatcgcattgtcattgaagagtttctggagggagaagaggccagctttatcgttatg
gtcgacggcgaacacgtgctgccgatggccaccagccaggatcataagcgagttggcgat
ggcgacagcggccccaataccggcggaatgggggcctattccccggcgccggtggtcagc
gatgcggtgcatcagcgggtaatggagcaggtgatttggccaaccgtacgcggtatggca
caggagggcgccccctatactggtttcctgtatgccggcctgatgatctcggccgacggc
gcgcccaaggtcattgagtttaactgtcgctttggcgatccggagacccagcccatcatg
atgcgcatgcagtccgatctggtcgcgctgtgtctggccggtgccaacggcaccctggac
cagcagtcatcggcatgggatccacgccccgcgctgggcgtcgtattagccgcaggtgga
tacccgggcgactatcgtcaaggcgacgtcattcacggtctcacccagggaaccgcgcag
gccaaagtgtttcacgccggaacccggctgaatgctcagggtgaggtcgaaacctgcggc
ggacgggtgctgtgtgcgacagcgctgggcgaggacattgccgaagcgcagcgcaatgcc
taccgtctggccgatgcattgagctgggagggcgggttctgccgccgcgatatcggctac
cgggcgctacagcgctag

DBGET integrated database retrieval system