KEGG   Edwardsiella piscicida C07-087: ETAC_00780Help
Entry
ETAC_00780        CDS       T02509                                 

Definition
(GenBank) IMP cyclohydrolase / Phosphoribosylaminoimidazolecarboxamide formyltransferase
  KO
K00602  phosphoribosylaminoimidazolecarboxamide formyltransferase / IMP cyclohydrolase [EC:2.1.2.3 3.5.4.10]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00230  Purine metabolism
etc00670  One carbon pool by folate
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    ETAC_00780
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    ETAC_00780
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:etc04147]
    ETAC_00780
Enzymes [BR:etc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.3  phosphoribosylaminoimidazolecarboxamide formyltransferase
     ETAC_00780
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.10  IMP cyclohydrolase
     ETAC_00780
Exosome [BR:etc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ETAC_00780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AICARFT_IMPCHas MGS CoA_binding_2
Motif
Other DBs
NCBI-ProteinID: AGH72289
Position
complement(180377..181966)
Genome map
AA seq 529 aa AA seqDB search
MQHSRPVRRALLSVSDKSGIVEFAQALHLRGVELLSTGGTARLLSQAGLPVTEVSDYTGF
PEMMDGRVKTLHPKVHGGILGRRDRDAAVMQQHGIQPIDMVVVNLYPFAQTVARPDCTLE
EAVENIDIGGPTMVRSAAKNHNDVAIVVNNGDFDNIIAEMDAHHGALTQATRFDLAIKAF
EHTAAYDSMIANYFGTLVAPYHGDTQSPSGRFPRTLNLNLIKKQDMRYGENGHQQAAFYI
EEPQVEACIATAQQLQGKALSYNNIADTDAALECVKSFAEPACVIVKHANPCGVALGDDP
LDAYERAYQTDPTSAFGGIIAFNRTLDAKTAQAIIARQFVEVIIAPHVTEDALDLLSAKQ
NVRVLACGEWDARIPGLDFKRVNGGLLVQDRDLGMVDVADLRVVTERQPSEQELRDALFC
WKVAKFVKSNAIVYARDNMTVGIGAGQMSRVYSAKIAGIKAADEGLPVAGSVMASDAFFP
FRDGIDAAAAVGIRCVIQPGGSIRDDEVIAAANEHGIAMIFTGMRHFRH
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgcaacacagtcgtcctgttcgccgcgcactgctgagtgtctccgataaatccggtatc
gtcgaattcgcccaggcgttacacctgcgcggcgttgagctgctctccaccggcggtacc
gcccgccttctgtcacaggccggtctgccggttaccgaggtttccgactacacaggcttt
cctgagatgatggacggacgcgtcaagaccctgcatcccaaagttcacggtgggatcctc
ggacgccgcgatcgcgacgctgccgttatgcagcagcatggtattcagcccatcgatatg
gtggtcgtcaacctctatccctttgctcaaaccgttgcgcgtcccgactgcacgctggaa
gaggcggtggagaatatcgatatcgggggaccaaccatggtgcgctccgcggcaaagaac
cataacgatgtcgctatcgtggttaacaacggcgattttgataacatcattgccgaaatg
gacgcccaccacggtgccctgacgcaggccacccgcttcgacctggccattaaggccttt
gagcatacggccgcctacgacagtatgatcgccaactactttggtacgctggtcgcgcct
taccacggcgatacccagagcccaagcggtcgtttcccgcggacgctaaaccttaaccta
ataaaaaaacaggatatgcgctacggcgagaacggccaccagcaggcggccttctatata
gaggagccacaggttgaagcctgcatcgcgacagcccagcagcttcaggggaaagcgctg
tcctacaataacattgccgataccgacgccgcgctggagtgcgtcaagagctttgccgaa
ccggcctgcgtcatcgttaagcatgcgaacccctgcggcgttgcgctcggcgacgatccg
ctcgatgcctatgagcgcgcctaccagaccgatcccacctccgcctttggcggcatcatc
gcctttaaccgtacgctggatgccaagaccgctcaggccatcatcgcgcgccagttcgtt
gaggtgatcatcgccccccatgtgaccgaggatgccttggatctcctcagcgccaagcaa
aacgtgcgcgttctggcctgcggcgagtgggatgcacgcatccccggtctggacttcaaa
cgggtcaacggcgggctattggtgcaggatcgcgatctcggaatggtggatgtcgccgat
ctgcgcgtggtcaccgaacgccagcccagtgagcaggagctgcgcgatgccttgttctgc
tggaaggtcgccaagtttgtgaagtccaacgccatcgtctacgcacgggataacatgacc
gttggcatcggcgccggacagatgagccgggtctattcagccaaaattgccggtatcaaa
gccgcggacgagggtctaccggtcgccggctccgtgatggcatccgatgccttcttcccg
ttccgtgacggtatcgatgccgccgccgccgtcggcatccgctgcgtcatccaaccgggg
ggctccattcgtgatgacgaggtcatcgccgccgccaacgaacacggcatcgccatgatc
tttaccggcatgcgccacttccgccactaa

DBGET integrated database retrieval system