KEGG   Edwardsiella piscicida C07-087: ETAC_00790Help
Entry
ETAC_00790        CDS       T02509                                 

Definition
(GenBank) acetyl-CoA synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00010  Glycolysis / Gluconeogenesis
etc00620  Pyruvate metabolism
etc00630  Glyoxylate and dicarboxylate metabolism
etc00640  Propanoate metabolism
etc00680  Methane metabolism
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01120  Microbial metabolism in diverse environments
etc01130  Biosynthesis of antibiotics
etc01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ETAC_00790
   00620 Pyruvate metabolism
    ETAC_00790
   00630 Glyoxylate and dicarboxylate metabolism
    ETAC_00790
   00640 Propanoate metabolism
    ETAC_00790
  09102 Energy metabolism
   00680 Methane metabolism
    ETAC_00790
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:etc01004]
    ETAC_00790
Enzymes [BR:etc01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     ETAC_00790
Lipid biosynthesis proteins [BR:etc01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   ETAC_00790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: AGH72291
Position
complement(188462..190417)
Genome map
AA seq 651 aa AA seqDB search
MSQIHTYPVPADIARHAFINAEMYREMYLASVEDPEAFWAEQGQIISWITPYSRVKNTSF
DPGHINIRWFEDGTLNLAANCLDRHLAERGEQTAIIWEGDDPQESRRVTYRQLHGEVCRF
ANVLKSLQVEKGDVVAIYMPMVVEAAVAMLACARIGAVHSVIFGGFSPEAVAGRIIDSGA
KLVITADEGVRAGRTIPLKRNVDEALQHPQVNSVHHVVVFRRTGGAGEWDSGRDRWWHEL
MAQADEHCPAVEMNAEDPLFILYTSGSTGKPKGVLHSTGGYLVYAATTFKYVFDYHPGDI
YWCTADVGWVTGHSYLLYGPLANGAITLMFEGVPNYPGINRLSQIVDKHQVNILYTAPTA
IRALMAEGQRAVADTQRTSLRIMGSVGEPINPEAWEWYYHTIGNGHCPIMDTWWQTETGG
FMITPLPGATVLKAGSATRPFFGVQPALVDNSGEILEGASEGNLVILDSWPGQARTLFGA
HERFEQTYFSTFKGMYFSGDGARRDEDGYYWITGRVDDVLNVSGHRLGTAEIESALVAHP
KIAEAAVVGIPHSIKGQAIYAYITLNVGEEPSPALYAEVRDWVRKEIGPIATPDILHWTD
ALPKTRSGKIMRRILRKIASGDISNLGDTSTLADPGVVEKLLEEKQAMQPR
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
atgagccagatccatacctaccctgttccggcggatattgcccggcatgcctttatcaat
gcggaaatgtatcgtgaaatgtatctggcctctgtcgaggaccccgaggcgttctgggcg
gagcagggacagatcatcagctggataaccccctatagccgggttaagaatacctccttc
gatccaggccatatcaatatccgttggtttgaggatggcaccctcaacctggcggccaac
tgcctggatcgccatctggccgaacgcggcgaacagacggccatcatctgggagggcgac
gatccgcaggagagccgcagagtaacctatcgccagctgcacggtgaggtgtgccgcttc
gccaacgtgctgaaatcactgcaggtagaaaagggcgacgtcgtcgcgatctatatgccc
atggtggtcgaggcggcggttgccatgctggcctgcgcgcgaattggcgccgtacactcg
gtgatcttcggtggcttctccccagaggcggttgccgggcgcattatcgactccggagcc
aaactggtgatcacggcagatgaaggggttcgcgccgggcgaaccattccactcaagcgc
aacgtcgacgaagcgctgcagcatcctcaggtcaacagcgtgcaccatgtcgtggtattc
cgccgtaccggcggcgccggcgaatgggacagcggccgcgatcgttggtggcatgagctg
atggcccaggccgatgaacactgccccgcggtggagatgaacgccgaagatccgctgttt
attctgtatacctccggatcgaccggtaaaccgaagggcgtactgcacagtaccggcggc
tatctggtatacgcggcgaccacctttaagtatgtgtttgactaccatcccggcgatatt
tactggtgtacggcggacgtcggctgggtcaccggccacagctatctgctgtatggcccc
ttggccaacggcgccataacgctgatgtttgagggggtccccaactatcccggcattaat
cgcctcagccagatcgtagacaagcatcaggtcaatattctgtataccgcgccgacggcg
atccgcgcgctgatggcagaggggcagcgcgccgtcgccgacacccagcggacctcgctg
cgcataatgggatcggtcggtgagccgatcaaccccgaggcctgggagtggtattaccat
accatcggcaacggccactgcccgatcatggatacctggtggcagaccgaaaccggcggc
tttatgatcaccccgctgcccggagccaccgtgcttaaagccggatcggccacccgcccc
ttttttggcgtacagcccgccctggtcgataacagcggggagatcctggagggcgccagt
gaaggcaatctggtgatcctggactcttggcccgggcaggcacgtacgctgtttggcgcc
catgaacgctttgaacagacctacttctccacctttaaggggatgtatttcagcggcgac
ggtgcccgacgtgacgaagacggctattactggataaccggtcgcgtcgacgatgtactc
aacgtctcaggacaccgcctgggcacagcggagatcgaatctgcgctggtcgcgcacccg
aagatcgccgaggcggccgtcgtcgggatcccccacagcattaaagggcaggcaatctat
gcgtatatcacgctgaacgtaggcgaggaaccatcgcccgcgctgtacgccgaggtccga
gactgggtacgtaaagagatcggtcccatcgccacaccggatatcctgcactggaccgat
gcgctgcccaaaactcgctccggcaagatcatgcgccgcatcctgcgcaaaattgccagc
ggcgatatcagcaatctgggcgatacctctacgctggccgatcctggcgtcgtagaaaaa
ctgctggaggagaaacaggctatgcagccgcgttaa

DBGET integrated database retrieval system