KEGG   Edwardsiella piscicida C07-087: ETAC_00800Help
Entry
ETAC_00800        CDS       T02509                                 

Gene name
tolC
Definition
(GenBank) outer membrane channel protein
  KO
K12340  outer membrane protein
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc01501  beta-Lactam resistance
etc01503  Cationic antimicrobial peptide (CAMP) resistance
etc02020  Two-component system
etc03070  Bacterial secretion system
Module
etc_M00646  Multidrug resistance, efflux pump AcrAD-TolC
etc_M00647  Multidrug resistance, efflux pump AcrAB-TolC/SmeDEF
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    ETAC_00800 (tolC)
  09132 Signal transduction
   02020 Two-component system
    ETAC_00800 (tolC)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    ETAC_00800 (tolC)
   01503 Cationic antimicrobial peptide (CAMP) resistance
    ETAC_00800 (tolC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:etc02000]
    ETAC_00800 (tolC)
   02044 Secretion system [BR:etc02044]
    ETAC_00800 (tolC)
   01504 Antimicrobial resistance genes [BR:etc01504]
    ETAC_00800 (tolC)
Transporters [BR:etc02000]
 Other Transporters
  Pores ion channels [TC:1]
   ETAC_00800 (tolC)
Secretion system [BR:etc02044]
 Type I secretion system
  alpha-Hemolysin/cyclolysin transporter [MD:M00325]
   ETAC_00800 (tolC)
  RTX toxin transporter [MD:M00326]
   ETAC_00800 (tolC)
  RaxAB-RaxC type I secretion system protein [MD:M00339]
   ETAC_00800 (tolC)
  AlgE-type Mannuronan C-5-Epimerase transporter [MD:M00571]
   ETAC_00800 (tolC)
Antimicrobial resistance genes [BR:etc01504]
 Gene sets
  Multipdrug resistance modules
   Multidrug resistance, efflux pump AcrEF-TolC [MD:M00696]
    ETAC_00800 (tolC)
   Multidrug resistance, efflux pump MdtEF-TolC [MD:M00697]
    ETAC_00800 (tolC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OEP Ribosomal_S5_C
Motif
Other DBs
NCBI-ProteinID: AGH72293
Position
complement(192312..193664)
Genome map
AA seq 450 aa AA seqDB search
MQVYQQAKESNPDLRQAAANRDAAFEKINESRSPLLPQLGLGADYTYTNGFRDSSGLNSN
NYGASLALTQTIFDMSKWRQLSLTEKQAGIQDVSYQSSEQTLMLNTATAYFNVLRAIDQL
TYTEANKQAIYNQLDQTTQRFNVGLVAITDVQNARAQYDQVLAQEVSARNNLDNSLEALR
QITGQYYPQLSALNIDRFSTKRPDDVKALLQEAEKRNLQLLSARLSQDLARQQIKYAETG
YMPTLNLTASTGVSNTDYNSLSNAQKETLRGGNGSSYQGQNTVGLSFNLPLYSGGATNSQ
VKQAQYNFVGASEALDSAHRSVVQNVRSSFNNISAAISGVSAYKQAVVSAQSSLDATQAG
YQVGTRTIVDVLNATTALYNAKQNLANARYDYLISQLNIKYALGTLNQNDLLALNGDLSK
PVPTAADSIAPDDAAQAAKANGPIPGGGVR
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtatatcagcaggccaaagaaagcaacccggatctccgtcaggccgccgctaac
cgcgacgctgcgtttgaaaagatcaatgagtcccgcagcccgctgctgccgcagctgggg
ctgggcgctgactatacctataccaacggctttcgcgacagcagcggcctgaactcaaat
aattacggggcgagcctggcgctgacgcagacaatcttcgatatgtccaaatggcgtcag
ctctcgctgactgaaaagcaggccgggattcaggatgtctcctatcagtcctctgaacag
acgctgatgctgaatactgccaccgcctactttaacgtgctgcgcgccatcgatcagctg
acgtataccgaagccaacaaacaggcgatttacaatcagctcgatcagacaacccagcgc
ttcaacgtcggcctggtggccattaccgacgtacagaacgcccgcgcgcagtacgatcag
gtgctggcccaagaggtcagcgcacgcaacaatctggataactcgctggaggccctgcgc
cagatcaccggccagtactatccacagctctccgccctgaatatcgatcgcttcagcacc
aagcgccctgacgatgtgaaagcgctgctgcaagaggcagagaagcgcaacctgcagctg
ttaagcgcccgtctgagccaggacctggcgcgtcagcagatcaagtatgccgaaaccggc
tatatgccgaccctgaacctgacggcctccaccggcgtcagcaataccgactataactcc
ctctccaacgcgcagaaagaaacgctgcggggtggcaacggtagcagctatcagggacag
aacaccgtgggcctgagctttaacctgccgctgtactccggcggcgccaccaactcacag
gtgaaacaggcgcagtacaactttgtcggcgccagcgaggccctggacagcgcccaccgc
agcgtggtgcagaatgtccgctcctccttcaacaacatctctgccgccatcagcggcgta
tcggcctataagcaggccgtggtctcagcccaaagctctttggacgccacccaggccggc
tatcaggtgggtacccgcaccatcgttgatgtgttgaacgccaccacggcgctgtacaac
gccaagcagaacctggccaacgcgcgctatgactacctgatcagccagctgaacatcaag
tatgcgctgggcacgctcaaccagaacgatctgctggcgctcaacggcgatctgagtaaa
ccagtcccgacggcggccgacagcattgcccctgacgatgcggcccaggccgccaaagcc
aatggaccgatccccggcggcggcgtacgctaa

DBGET integrated database retrieval system