KEGG   Edwardsiella piscicida C07-087: ETAC_00855Help
Entry
ETAC_00855        CDS       T02509                                 

Gene name
pgi
Definition
(GenBank) glucose-6-phosphate isomerase
  KO
K01810  glucose-6-phosphate isomerase [EC:5.3.1.9]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00010  Glycolysis / Gluconeogenesis
etc00030  Pentose phosphate pathway
etc00500  Starch and sucrose metabolism
etc00520  Amino sugar and nucleotide sugar metabolism
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01120  Microbial metabolism in diverse environments
etc01130  Biosynthesis of antibiotics
etc01200  Carbon metabolism
Module
etc_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
etc_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ETAC_00855 (pgi)
   00030 Pentose phosphate pathway
    ETAC_00855 (pgi)
   00500 Starch and sucrose metabolism
    ETAC_00855 (pgi)
   00520 Amino sugar and nucleotide sugar metabolism
    ETAC_00855 (pgi)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:etc04147]
    ETAC_00855 (pgi)
Enzymes [BR:etc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.9  glucose-6-phosphate isomerase
     ETAC_00855 (pgi)
Exosome [BR:etc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   ETAC_00855 (pgi)
  Exosomal proteins of other body fluids (saliva and urine)
   ETAC_00855 (pgi)
  Exosomal proteins of colorectal cancer cells
   ETAC_00855 (pgi)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGI
Motif
Other DBs
NCBI-ProteinID: AGH72304
Position
209373..211022
Genome map
AA seq 549 aa AA seqDB search
MKNINPTRTAAWQALQQHFEQMKSVQMRDLFAADADRFSKFSATFDDQMLVDYSKNRINA
ETLEKLQALARETDLQGAIAAMFAGEKINRTEDRAVLHIALRNRSNTPIYVDGKDVMPEV
NAVLAKMKQFCARVIDGEWRGYTGKTITDVVNIGIGGSDLGPYMVTEALRPYKNHLAMHF
VSNVDGTHIAETLQRLNPETTLFLVASKTFTTQETMTNAHSARDWFLQAAGDERHVAKHF
AALSTNAQAVAAFGIDTANMFEFWDWVGGRYSLWSAIGLSIALSIGYDNFEQLLAGAHAM
DRHFASAPLQQNLPVLLALIGIWYNNFFGAETEAILPYDQYMHRFPAYFQQGNMESNGKY
VDRNGQAVDYQTGPIIWGEPGTNGQHAFYQLIHQGTKLIPCDFIAPAISHNPLGDHHSKL
LSNFFAQTEALAFGKSREAVEEEFAKAGKSAAEVQHIVPFKVFEGNRPTNSILLREITPY
SLGMLIALYEHKIFTQGAILNIFSFDQWGVELGKQLANRILPELEDAQPVRSHDSSTNAL
INRFKAWRA
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatatcaacccgacccgtactgctgcctggcaagcgctgcagcagcatttcgag
cagatgaagtccgtgcagatgcgcgatctgttcgccgcggatgccgaccgtttctctaag
ttctctgctaccttcgacgatcagatgctggtcgattactccaagaaccggattaacgca
gagaccctggaaaagctgcaggcgctggcccgtgaaaccgatctgcagggcgctatcgcc
gccatgttcgccggtgaaaaaatcaaccgtaccgaggatcgcgccgtgctgcacatcgca
ctgcgcaaccgtagcaatacgccgatctacgtcgacggtaaagacgtgatgccggaggtt
aacgccgtactggctaagatgaagcagttctgtgcgcgggtgatcgacggcgagtggcgg
ggttacaccggtaagacgattaccgacgtggtgaatattggtatcggcggctccgatctc
ggcccttacatggtgaccgaggcgctgcgcccttacaaaaatcacctggctatgcacttt
gtctccaacgtcgacggcacgcacatcgccgagacgctgcagcgcctgaacccggagacg
accctgttcctggtggcctcgaagaccttcaccacccaggagaccatgaccaatgcccac
agcgctcgcgattggttcctgcaggcggccggcgatgagcgccacgtggccaagcatttt
gccgcgctctccaccaatgcgcaggcggtggcggcgttcggtatcgataccgccaacatg
tttgagttctgggactgggtcggcggccgctacagcctgtggtcagccatcgggctctct
atcgctctgagcatcggctacgataactttgagcagctgctggccggcgcccacgccatg
gaccgccactttgccagcgcgccgctgcagcagaacctaccggtactgctggcgctgatc
ggcatctggtataacaacttcttcggtgccgaaaccgaagccattctgccctacgatcag
tatatgcaccgcttcccggcctatttccagcagggcaatatggagtcgaacgggaaatat
gtcgatcgcaacggtcaggccgtggattaccagaccggtcccatcatctggggcgagccg
ggcaccaacggccagcacgcgttctatcagctgatccaccagggcactaagctgattccc
tgcgactttatcgcgccggccatcagccataacccgctgggcgatcatcacagcaagctg
ctgtccaacttctttgcccagaccgaggcgctggcgttcggtaaatcccgtgaggcggtc
gaagaggagtttgccaaggcgggcaagagcgcggcagaggtgcagcatatcgtgccgttt
aaggtgtttgaggggaatcgcccgaccaactccatcctgctgcgtgaaatcacgccgtac
agcctggggatgctgattgcgctgtatgagcataagatcttcacccagggcgccattctg
aacatcttctccttcgatcagtggggggttgagctgggtaaacagctggctaaccgtatc
ctgccggagctggaggatgcgcagccggtacgcagccacgatagttcgaccaatgccctg
atcaaccgtttcaaggcctggcgggcataa

DBGET integrated database retrieval system