KEGG   Edwardsiella piscicida C07-087: ETAC_00870Help
Entry
ETAC_00870        CDS       T02509                                 

Gene name
malG
Definition
(GenBank) maltose transporter permease
  KO
K10110  maltose/maltodextrin transport system permease protein
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02010  ABC transporters
Module
etc_M00194  Maltose/maltodextrin transport system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    ETAC_00870 (malG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:etc02000]
    ETAC_00870 (malG)
Transporters [BR:etc02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Maltose/maltodextrin transporter [MD:M00194]
    ETAC_00870 (malG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1 OATP
Motif
Other DBs
NCBI-ProteinID: AGH72307
Position
complement(213069..213959)
Genome map
AA seq 296 aa AA seqDB search
MAMVQPQSLRYRLWLTHLLMILFIALIMFPLLMVIAISLRAGNFATGSLIPDQISWEHWK
LALGISVTAPDGRVTPPPFPVLLWLWNSIKVAVTTALGILTLSTTCAYAFARMRFRGKSS
LLKGMLIFQMFPAVLSLVALYALFDRIGQYVPFLGLNTLGGVIFAYMGGIALHVWTIKGY
FETIDGSLEEAAALDGATPWQAFRLVLLPLSVPILAVVFILSFIAAITEVPVASLLLRDV
NTYTLAVGMQQYLNPQNYLWGDFAAAAVLSAMPITAVFLLAQRWLVGGLTAGGVKG
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atggccatggttcaaccccaatccctgcgctatcgcctatggctcacccatttgctgatg
attctgtttatcgcgctgatcatgttccccctgctgatggtgatcgccatttcgctgcgc
gccggcaactttgccaccggtagcctgatcccggaccagatctcctgggagcactggaag
ctggcgctgggcatcagcgtgacggcgccggacggccgcgtgaccccgccgccgtttccc
gtgctgctgtggctgtggaactcgatcaaggtcgctgtcaccaccgcgctgggtatcctg
acgctctccaccacctgcgcctatgccttcgcccgcatgcgattccgcggcaaatcctcg
ctgctgaaagggatgctgattttccagatgttcccggcggtactgtcgctggtcgcgctg
tatgccctgttcgatcggatcggccagtatgtgccgttccttggcctgaataccctgggg
ggcgtcatcttcgcctatatgggcggtatcgccctgcacgtttggaccatcaagggctac
tttgaaaccatcgacggctcgctggaggaggcggcggcgctggatggcgccacgccgtgg
caggcgttccgactggtactgctgccgctttccgtaccgatactggcggtggtgttcatc
ctctcctttatcgccgccatcaccgaggtgccggtcgcctcgctgctgctgcgcgacgtc
aacacctatacgctggcggtcggcatgcagcagtatctcaatccgcagaactacctgtgg
ggggattttgccgcggcggcggtgctgtcggcgatgccgataaccgccgtcttcctgctg
gcgcagcgttggctggtgggcggtctgaccgccggcggcgtgaaaggctag

DBGET integrated database retrieval system