KEGG   Edwardsiella piscicida C07-087: ETAC_00880Help
Entry
ETAC_00880        CDS       T02509                                 

Gene name
malE
Definition
(GenBank) maltose ABC transporter periplasmic protein
  KO
K10108  maltose/maltodextrin transport system substrate-binding protein
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02010  ABC transporters
etc02030  Bacterial chemotaxis
Module
etc_M00194  Maltose/maltodextrin transport system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    ETAC_00880 (malE)
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    ETAC_00880 (malE)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:etc02000]
    ETAC_00880 (malE)
Transporters [BR:etc02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Maltose/maltodextrin transporter [MD:M00194]
    ETAC_00880 (malE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_8 SBP_bac_1 SBP_bac_6
Motif
Other DBs
NCBI-ProteinID: AGH72309
Position
complement(215683..216876)
Genome map
AA seq 397 aa AA seqDB search
MTKTSAIKTIALSALAALVISAPALAKIEEGKLVIWINGDKGYNGLADVGKKFEQETGIK
VTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEIHPSKAFQEKLYPFTW
DAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKSWEEIPALDSKLRAQGKSAIMWNLQEP
YFTWPLIAADGGYAFKYANGRYETNNVGVDNAGSRAGLQFLVDMVKNKHINADTDYSIAE
AAFNKGQTAMTINGPWAWSNIDKSGINYGITLLPTFKGHPSKPFVGVLSAGINAASPNKE
LATEFIENYLLTDSGLAMVNQDKPLGAVALKSYQEILEKDPRIAATMQNSQNGEIMPNIP
QMSAFWYAERAAIINAINGRQSVTQALESAKERILKK
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgacaaagacatccgctataaaaaccatcgctcttagcgcactggccgcactggtcatc
tctgcgccggcgctggccaagatcgaagagggtaaactggtcatctggatcaacggtgac
aaggggtataacggtctggcggacgtgggcaagaagttcgagcaggagaccggtatcaag
gtcaccgtagagcacccggacaagctggaggagaaattcccccaggttgcggccaccggt
gacggaccagacattatcttctgggcccatgaccgctttggcggctatgcccagtccggc
ctgctggccgaaatccatccgtccaaagcgtttcaggagaagctctacccctttacctgg
gacgccgtgcgctacaacggcaagctgatcgcctaccccatcgccgtcgaggcgctgtcg
ctgatttataacaaagatctgctgcccaacccgcccaagagctgggaagagatcccggcg
ctggacagcaagctgcgcgcccagggcaagagcgccatcatgtggaacctgcaggagccc
tacttcacctggccgctgatcgccgccgacggtggctacgctttcaagtatgccaacggc
cgctacgagaccaataacgtcggcgtcgacaacgccggatcgcgcgccggtctgcagttc
ctggtcgatatggtgaaaaacaagcatatcaacgccgataccgactactccatcgccgag
gcggcctttaacaaagggcagaccgccatgaccatcaacggcccctgggcctggtccaat
atcgacaagagcggcatcaactacggcatcaccctgctgccgaccttcaagggacatcct
tccaagcccttcgtcggcgtgctgagcgcggggatcaacgcggccagcccgaacaaagag
ctggcgaccgagttcattgagaactacctgctgaccgacagcggcctggcgatggtcaac
caagacaagccgctgggcgccgtggcgctgaagtcgtatcaggagatcctggagaaggat
ccgcgcatcgccgccaccatgcagaactcgcaaaacggtgagatcatgccgaatatcccg
cagatgagcgccttctggtacgccgagcgcgccgcgatcatcaacgcgatcaacggccgt
cagagcgtgacgcaggcgttggaaagcgccaaggagcggatcctcaaaaaataa

DBGET integrated database retrieval system