KEGG   Edwardsiella piscicida C07-087: ETAC_00885Help
Entry
ETAC_00885        CDS       T02509                                 

Definition
(GenBank) maltose/maltodextrin transporter ATP-binding protein
  KO
K10111  multiple sugar transport system ATP-binding protein [EC:3.6.3.-]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02010  ABC transporters
Module
etc_M00194  Maltose/maltodextrin transport system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    ETAC_00885
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:etc02000]
    ETAC_00885
Enzymes [BR:etc01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.-  
     ETAC_00885
Transporters [BR:etc02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Maltose/maltodextrin transporter [MD:M00194]
    ETAC_00885
   Arabinogalactan oligomer/maltooligosaccharide transport system [MD:M00491]
    ETAC_00885
   Trehalose/maltose transporter [MD:M00204]
    ETAC_00885
   Putative sorbitol/mannitol transporter [MD:M00200]
    ETAC_00885
   Putative multiple sugar transporter [MD:M00207]
    ETAC_00885
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran TOBE_2 OB_MalK RsgA_GTPase AAA_21 SMC_N TOBE AAA_16 AAA_22 AAA_23 AAA_29 AAA_15 AAA_33 AAA NTPase_1 Rad17 AAA_30 AAA_28 AAA_25 NACHT MMR_HSR1 ATPase_2 RNA_helicase NB-ARC
Motif
Other DBs
NCBI-ProteinID: AGH72310
Position
217361..218470
Genome map
AA seq 369 aa AA seqDB search
MANVSLRNVYKAYGEAVISRDINLDIEDGEFVVFVGPSGCGKSTLLRMIAGLEDITSGEL
QIAGVRMNDVPPAKRGIGMVFQSYALYPHLSVADNMSFGLKLAGVNKAEIQRRVNQVAEI
LQLAHLLDRRPKALSGGQRQRVAIGRTLVAEPDVFLLDEPLSNLDAALRVQMRIEISRLH
KRLQRTMIYVTHDQVEAMTLADKIVVLDAGRIAQVGKPLALYHYPADRFVAGFIGSPKMN
FLPVKVSEAQPQRVRVELPNGQHIWLPVAGEGLRPGSNLSLGIRPEHLVPSAAADVTLSG
EVQVVEQLGNETQIHIQIPALRQNLVYRQNDVVLVDEGATLAIGLPAERCHLFREDGSAC
QRLYQEPGV
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atggcgaacgtatcactgcgtaatgtgtataaggcgtacggtgaggccgtgatctcccgg
gatattaacctggacattgaggatggcgagtttgtggtgttcgttggcccctcgggctgc
ggtaaatcgacgctgctgcgcatgatcgccggcctggaggacattacctccggcgagctg
cagatcgccggggtgcggatgaacgatgtgccaccggcgaagcgcggcatcggcatggtg
tttcagtcctacgccctgtatccgcacctgtcggtcgcggacaacatgtcgtttggcctc
aagctggccggcgtcaacaaggcggagatccagcggcgggtgaatcaggtcgcggagatc
ctgcagctggcgcatctgctggataggcgccccaaggcgctctccggcggccagcgtcag
cgggtggccattggccgtaccctggtggcggagccggatgtcttcctgctggatgagccg
ctctctaacttggatgccgcgctgcgggtgcagatgcgcatcgagatctcccgcctgcat
aagcgcctgcagcgcaccatgatttatgtcacccacgatcaggttgaggcgatgaccctg
gcagacaagattgtggtgctggacgccgggcgcattgctcaggttggtaagccgctggcg
ctgtatcactatcccgccgatcggtttgtcgccggttttatcggctcccccaaaatgaac
ttcctgccggtcaaagtgagcgaggcgcagccgcagcgcgtacgggttgagctccccaac
ggccagcatatctggctgccggtggcgggagagggactgcgtcccggcagcaacctgtcg
ctggggatccgccccgaacatctggtgcccagcgccgcggccgatgtgacgctgtcgggc
gaggttcaggttgtcgaacagctgggtaacgaaacccagatccatatccaaatcccggcc
ctgcgtcaaaacctggtgtaccgccagaacgacgtggtgttggtcgatgaaggcgccacg
ctggccatcggcctgcctgcggaacgttgccacctgtttcgagaggacggcagcgcctgt
cagcggttgtatcaggagccgggagtgtag

DBGET integrated database retrieval system