KEGG   Edwardsiella piscicida C07-087: ETAC_00900Help
Entry
ETAC_00900        CDS       T02509                                 

Definition
(GenBank) chorismate--pyruvate lyase
  KO
K03181  chorismate--pyruvate lyase [EC:4.1.3.40]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00130  Ubiquinone and other terpenoid-quinone biosynthesis
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
Module
etc_M00117  Ubiquinone biosynthesis, prokaryotes, chorismate => ubiquinone
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    ETAC_00900
Enzymes [BR:etc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.40  chorismate lyase
     ETAC_00900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Chor_lyase
Motif
Other DBs
NCBI-ProteinID: AGH72313
Position
221083..221586
Genome map
AA seq 167 aa AA seqDB search
MAEHSAALANIDWQPLADAAAPADYGSWLAEQGSMTRRLEQRCDRLQVTVLREGPVDATQ
LSDDERGQLSPCAQYWLREVILLGDGIPWLFGRTLTPSSTLQGEGEALRRLGSTPLGRYL
FSGVALERESLRVGCLGPLWARRSRLRVAGQPLLLTELFLADAPIYG
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atggcagaacattctgctgcgctggcgaatatcgactggcagccgttggctgacgcggcg
gcgccggcggactacggcagctggctggcggagcagggatcgatgacccgccgcctggag
cagcggtgcgacaggctacaggtgacggtgctgcgcgaagggccggtggacgctacgcag
ctgagcgacgatgagcgcgggcagctgtcgccctgtgcgcagtattggctgcgagaggtg
atcctgctcggcgatggtatcccttggctgtttggccgaaccctgacgccttccagcacg
ctgcagggcgaaggcgaggcgctgcggcggctggggagtaccccgctggggcgctatctg
ttcagcggggtcgccctggagcgcgagtcgctgcgggttggctgtctgggcccgctctgg
gcccgtcgcagccgactgcgcgtcgccggtcagccgctgctgctgacggagctgttcttg
gccgatgcccctatctatggataa

DBGET integrated database retrieval system