KEGG   Edwardsiella piscicida C07-087: ETAC_00920Help
Entry
ETAC_00920        CDS       T02509                                 

Definition
(GenBank) Diacylglycerol kinase
  KO
K00901  diacylglycerol kinase (ATP) [EC:2.7.1.107]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00561  Glycerolipid metabolism
etc00564  Glycerophospholipid metabolism
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    ETAC_00920
   00564 Glycerophospholipid metabolism
    ETAC_00920
Enzymes [BR:etc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.107  diacylglycerol kinase (ATP)
     ETAC_00920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAGK_prokar
Motif
Other DBs
NCBI-ProteinID: AGH72317
Position
227080..227442
Genome map
AA seq 120 aa AA seqDB search
MNSTTGLTRIIKAAGYSIKGLQAAWRHEAAFRQESLLLAAAVALACWLDVTAVERILLIG
SVTLVVILEILNSAIEAVVDRIGSERHELSGRAKDMGSAAVFVALWLALFVWVSILWTHW
NT seq 363 nt NT seq  +upstreamnt  +downstreamnt
atgaatagtactacaggtttgactcgaatcattaaagcggccggttactcgatcaaaggg
ctgcaggcggcatggcgccatgaggcggcgttccgtcaggagagtctgctgctggctgcc
gcggtggcgctggcctgctggcttgacgtcacggcggtcgagcgcattttgctgatcggc
agcgtgacgctggtggtgatcctggaaatcctcaacagcgccatagaggcggtggtggat
cggattggcagcgagcgccatgagctgtccggccgcgccaaagatatgggatcggcggcg
gtattcgtggcgctgtggttggcgctgtttgtttgggtcagcattctgtggacgcattgg
taa

DBGET integrated database retrieval system