KEGG   Edwardsiella piscicida C07-087: ETAC_00925Help
Entry
ETAC_00925        CDS       T02509                                 

Definition
(GenBank) citrate:succinate antiporter
  KO
K09477  citrate:succinate antiporter
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ETAC_00925
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:etc02000]
    ETAC_00925
Transporters [BR:etc02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   ETAC_00925
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Na_sulph_symp CitMHS
Motif
Other DBs
NCBI-ProteinID: AGH72318
Position
complement(227565..228977)
Genome map
AA seq 470 aa AA seqDB search
MGIMFMIPVPDGMPPQAWHYFAVFVAMIVGMILEPIPATAISFIAVTIVVIGNQFLLFDA
KELADPAFNASKQALKWGLAGFSSTTVWLVFGAFIFALGYEVSGLGRRIALLLVKFMGKR
TLTLGYAIVIIDILLAPFTPSNTARTGGTVFPVIKNLPPLFDSHPNDPSSRRIGSYLMWM
MVISTSISSSMFVTGAAPNVLGLEFVSKIAGIQISWMQWFLGFLPVGLLLLIVAPWLSYV
LYKPTVTHSEQVATWAGSALKEMGALTRREITLICLVLLSLALWVFGDDFINATAVALLA
VALMLALHVVPWKDVTKYSGAWNTLVNLSTLVVMANGLTRSGFIEWFAKTMSTHLAGFSP
TATVIALVLVFYFAHYLFASLTAHTATMLPVILAVAQSIPGVPMDQLCLLLVLSIGLMGC
LTPYATGPGIIIYGCGYVKSQDYWRLGAIFGVIYIAALLGIGWPIMAMWN
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atggggattatgtttatgatcccagtccccgatggcatgccgccgcaggcctggcactat
tttgccgtgtttgtcgccatgatcgtcgggatgatccttgagcccatcccggccaccgcc
atcagctttatcgccgtgaccatcgtcgttatcggtaaccagttcctgctgtttgacgcc
aaagagctggccgatcccgccttcaacgccagtaaacaggcgctgaagtggggcctggcc
ggcttctccagcaccaccgtgtggttggtgttcggcgcctttatctttgccctgggctat
gaggtcagcggactgggtcggcgtatcgccctgctgctggtcaagttcatgggtaagcga
acgctcactctcggctacgccatcgtcatcattgatattctgctggcgccctttacaccg
tctaacaccgcgcgtaccggcggcaccgtctttccggtgatcaaaaacctgccgccgctg
ttcgactcccatcccaacgatccctcttcacgccgcatcggtagctatctgatgtggatg
atggtgatcagtaccagcatcagctcctccatgttcgtcaccggcgccgcgccgaacgta
ctgggcctggagtttgtcagtaaaatcgccggtatccagatctcctggatgcagtggttc
ctcggcttcctgccggtggggctgctgctgctgatcgtcgccccgtggctctcctacgtg
ctgtacaagccgaccgtgacccacagcgagcaggtcgccacctgggccggtagcgcgctg
aaagagatgggcgccctgacccgccgtgaaatcaccctgatctgcctggtgctgctgagc
ctggcgctgtgggtctttggcgatgatttcatcaacgccaccgccgtcgccctgctggcg
gttgccctgatgctggcgctgcacgtggtgccgtggaaggatgtcaccaagtacagcggc
gcctggaataccctggtcaacctgtctaccctggtggtgatggccaacgggctgacccgc
tccggctttatcgaatggttcgccaaaaccatgagcacccatctggccggtttctcaccg
accgcgacggtcatcgccctggtgctggtgttctacttcgcccactacctgttcgccagc
ctgaccgcccacaccgccaccatgctgccggtgatcctggccgtcgcccaaagcattccg
ggggttccgatggaccagctgtgtctgctgctggtgctctctatcggcctgatgggctgt
ctgaccccttacgccaccggcccggggatcatcatctacggctgtggctatgtgaaatct
caggattactggcgacttggcgccatctttggggttatctatatcgccgcgctgctgggc
atcggttggcctatcatggccatgtggaactaa

DBGET integrated database retrieval system